KEGG   Mus musculus (mouse): 20347
Entry
20347             CDS       T01002                                 

Symbol
Sema3b, SemA, Semaa, sema5, semaV
Name
(RefSeq) sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B
  KO
K06840  semaphorin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    20347 (Sema3b)
SSDB
Motif
Pfam: Sema ig V-set Ig_3 Ig_6 PSI I-set
Other DBs
NCBI-GeneID: 20347
NCBI-ProteinID: NP_001036244
MGI: 107561
Ensembl: ENSMUSG00000057969
Vega: OTTMUSG00000016526
UniProt: M9MMK0
Position
9:complement(107474873..107486440)
AA seq 749 aa
MGRAEAAAMIPGLALLWVAGLGDTAPNLPRLRLSFQELQARHGVRTFRLERTCCYEALLV
DEERGRLFVGAENHVASLSLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLL
HTYNHTHLLACGTGAFHPTCAFVEVGHRLEEPMLQLDRRKLEDGKGKTPYDPRHRAASVL
VGEELYSGVTADLMGRDFTIFRSLGQNPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDD
KIYFFFRESAVEAAPAMGRMSVSRVGQICRNDLGGQRSLVNKWTTFLKARLVCSVPGVEG
DTHFDQLQDVFLLSSRDRQTPLLYAVFSTSSGVFQGSAVCVYSMNDVRRAFLGPFAHKEG
PTHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNPVLPMGGRPL
FLQVGAGYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPNSEGLLLEELQ
VFEDSAAITSMQISSKRQQLYIASRSAVAQIALHRCTALGRACAECCLARDPYCAWDGSA
CTRFQPTAKRRFRRQDIRNGDPSTLCSGDSSHSVLLEKKVLGVESGSAFLECEPRSLQAH
VQWTFQGAGEAAHTQVLAEERVERTARGLLLRGLRRQDSGVYLCVAVEQGFSQPLRRLVL
HVLSAAQAERLARAEEAAAPAPPGPKLWYRDFLQLVEPGGGGGANSLRMCRPQPGHHSVA
ADSRRKGRNRRMHVSELRAERGPRSAAHW
NT seq 2250 nt   +upstreamnt  +downstreamnt
atggggcgggctgaggccgccgccatgatcccaggcctggcccttctctgggtagcaggg
ctaggggatactgcccctaaccttccccgccttcggctctcctttcaagaattacaggcc
cggcatggtgtccgaaccttcaggctggagcggacctgctgttatgaagccttgctggtg
gatgaggagcgtggacgcctgtttgtgggtgctgagaaccacgtggcttccctcagcctg
gacaacatcagcaagcgagccaagaagctggcctggcccgcccccgtggaatggcgtgaa
gaatgcaactgggcagggaaggacattggtaccgagtgcatgaacttcgtgaagctgctg
cacacctacaaccacacccacttgctggcctgtggcacaggggctttccacccaacctgt
gcctttgtggaggtgggccaccggctggaggaacccatgcttcaactggaccggaggaaa
cttgaggacggcaaggggaagactccttatgacccaaggcatcgggctgcctcggtgctg
gtgggggaagaactgtattctggggtgacagcagaccttatgggccgggactttaccatc
tttcgaagccttggtcagaatccgagtctccgaacagagccccatgattcccgctggctc
aatgaacccaagtttgtcaaggtcttttggatcccagagagtgagaaccctgatgacgat
aaaatctatttcttcttccgcgagtccgctgtggaagcagcaccagcaatggggcgcatg
tctgtgtctcgtgttggccagatctgcaggaatgacctgggtggccagcggagcttggtc
aacaaatggaccacatttctgaaggcgcggcttgtgtgctcagtacctggagttgagggt
gacacccactttgaccaacttcaggatgttttccttctgtcctcccgagaccgccagaca
cctcttctctatgctgtcttctccacctccagtggtgtcttccagggctctgctgtgtgc
gtgtacagcatgaacgatgtgcgccgagccttcttgggaccttttgctcacaaagagggg
cctacacaccagtgggtgtcctaccagggtcgtgtcccctacccaagacctggcatgtgc
cccagcaagacctttggcaccttcagctccaccaaggacttcccagatgacgttatccag
tttgctcggaaccaccctctcatgtacaacccagtcctgcccatgggggggcgccctctc
ttcctacaagtgggagctgggtacaccttcacccaaatcgccgcagaccgagtagcagct
gccgatggacactacgatgttctcttcattggtacagatgtgggcacagtgctgaaagtg
atctcagtccccaaaggcagccgacctaattctgaaggacttctcctggaagagctgcag
gtgttcgaggactctgccgctatcaccagcatgcaaatctcctctaaaaggcaacaactc
tacatagcatcgcgcagcgcagtggcccagattgctttgcatcgctgcactgccctaggc
cgcgcctgcgcagaatgctgcttggcccgtgatccttactgcgcctgggatggatcagct
tgcacacgcttccagcctacggccaagagacggttccggaggcaagacataaggaatggc
gaccccagcaccctatgctctggagactcttctcactctgtgctgctggagaagaaggtg
ttgggtgtggagagcggcagcgcgtttctggagtgtgagccccgctcgctccaggcgcat
gtgcagtggaccttccaaggtgcaggggaggcagctcacacccaggtgctggctgaggag
agagtagagcgcactgcgcgggggctgctgttgcgggggctgcggcgccaggactctggc
gtgtatctttgcgtcgcggttgaacaaggcttttcacaaccactgcgtcgcctggtgctg
catgtgttgagtgcggcgcaggctgaacgactggcacgggcagaggaagcagccgctcct
gcacctcctggccctaaactctggtaccgggactttctgcagttggtggagccaggcggt
ggcggaggtgcaaactccctgcgaatgtgccgcccgcagcccgggcaccactctgtggca
gcagattcacgtcgtaagggtcgcaacagacggatgcatgtctctgagctccgtgctgag
cgtggaccacgtagtgcagctcactggtga

DBGET integrated database retrieval system