KEGG   Mus musculus (mouse): 20348
Entry
20348             CDS       T01002                                 

Symbol
Sema3c, 1110036B02Rik, SemE, Semae
Name
(RefSeq) sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C
  KO
K06840  semaphorin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    20348 (Sema3c)
SSDB
Motif
Pfam: Sema I-set Ig_3 PSI Ig_6 Ig_2 ig V-set
Other DBs
NCBI-GeneID: 20348
NCBI-ProteinID: NP_038685
MGI: 107557
Ensembl: ENSMUSG00000028780
Vega: OTTMUSG00000035305
UniProt: Q62181
Position
5:17779814..17935266
AA seq 751 aa
MAFRAICVLVGVFICSICVRGSSQPQARVYLTFDELRETKTSEYFSLSHQQLDYRILLMD
EDQDRIYVGSKDHILSLNINNISQEPLSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQ
TFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
EELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKV
YFFFKERLTDNNRSTKQIHSMIARICPNDTGGQRSLVNKWTTFLKARLVCSVTDEDGPET
HFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPN
HQLISYQGRIPYPRPGTCPGGAFTPNMRTTKDFPDDVVTFIRNHPLMYNSIYPIHRRPLI
VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNSSASGELILEELEVF
KNHVPITTMKISSKKQQLYVSSNEGVSQVSLHRCHIYGTACADCCLARDPYCAWDGHSCS
RFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVRNNSTFLECAPKSPQAS
IKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQDSDQGLYHCIATENSFKQTIAKINFK
VLDSEMVAVVTDKWSPWTWAGSVRALPFHPKDILGAFSHSEMQLINQYCKDTRQQQQLGE
EPQKMRGDYGKLKALINSRKSRNRRNQLPES
NT seq 2256 nt   +upstreamnt  +downstreamnt
atggcattccgggcgatttgtgtgttggttggagtatttatttgttccatttgtgtacga
ggatcttcccagccccaagcaagagtttatttaacatttgatgagcttcgagaaaccaaa
acctctgagtactttagtctgtcccaccagcagttagactacagaatattgctgatggat
gaagatcaagaccggatatatgtggggagcaaagaccacatcctgtctttgaatatcaac
aatatcagtcaagaacctttgagtgttttctggccagcatcaacaatcaaagttgaagag
tgcaaaatggctggcaaagatcctacacatggctgtggaaatttcgtccgggtgattcag
acattcaaccgtactcacctgtatgtctgtgggagtggagcgttcagcccagtgtgcacc
tacctgaaccggggaaggaggtcagaggaccaggtattcatgatcgactctaagtgtgaa
tctggcaaaggacgatgctctttcaacccgaatgtgaacactgtgtctgttatgatcaat
gaggaactcttctcaggaatgtatatagacttcatgggaacagatgctgctattttccga
agtttaactaagaggaatgcagttcgaactgatcaacataattcaaaatggctgagtgaa
cccatgtttgtggacgcacatgtgatcccagatggcactgatccaaatgatgctaaggtc
tatttcttcttcaaagaaagactgactgacaacaataggagcacaaaacagattcattcc
atgattgcaagaatatgccctaatgacactggtggacaacgtagtcttgtcaacaagtgg
accacattcttaaaggcaagacttgtatgctcagtcacagatgaagatggcccagagaca
cattttgatgaactagaggatgtctttctgctggaaactgacaatccaaggacaacactc
gtgtatggcatcttcaccacatcaagctctgtttttaagggatcggcagtgtgtgtgtat
catttatctgatatacagactgtattcaatgggccctttgcccacaaggaagggcccaat
caccagctgatctcctatcaaggtagaatcccatatcctcgcccaggaacttgcccagga
ggggcctttacacccaatatgagaaccaccaaggacttcccagatgacgttgtcactttt
attcggaaccaccctctcatgtacaattccatctaccccatccacagaaggcctctgata
gtccgcataggcactgactacaagtacacaaagattgctgtggaccgtgtcaacgctgct
gatgggagataccacgttctgtttctgggcacagatcggggcaccgtgcagaaggtcgta
gtccttcctaccaatagctctgccagtggggaactcatcctggaggagctggaagtcttc
aagaatcatgttcccataacaacaatgaaaatctcatccaaaaagcaacagttgtacgtg
agctccaatgagggggtttcccaagtctctctgcatcgctgccatatctacggcacagcc
tgtgcggactgctgcttggcgagggatccatactgtgcctgggatggccactcttgctct
aggttctaccccactgggaagcggaggagccgaagacaagatgtgagacatggaaaccca
ctgacacaatgccgagggttcaatctgaaagcatacagaaatgcagctgaaattgttcag
tatggagtaagaaataacagcactttccttgagtgtgctcccaagtctccacaggcatct
atcaagtggttgctgcagaaagacaaagacaggaggaaggaggttaaactgaacgagcgc
attatagctacttcccaaggactactgattcgctctgttcaagattctgaccaaggactc
taccactgcattgccactgagaacagcttcaaacagaccatagccaagatcaacttcaaa
gttttagattcagaaatggtggccgttgtgacagacaagtggtccccgtggacatgggct
ggctctgtgagggctctacccttccatccaaaggacatcctgggggcattcagccactcg
gaaatgcagctcatcaatcagtactgcaaagacacccggcagcagcagcagctgggggaa
gaaccacagaagatgagaggggactatggcaagctgaaggctctcatcaacagcaggaaa
agcagaaacaggaggaatcagcttccagagtcataa

DBGET integrated database retrieval system