KEGG   Mus musculus (mouse): 20354Help
Entry
20354             CDS       T01002                                 

Gene name
Sema4d, CD100, Semacl2, Semaj, Semcl2, coll-4
Definition
(RefSeq) sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
  KO
K06521  semaphorin 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    20354 (Sema4d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    20354 (Sema4d)
CD molecules [BR:mmu04090]
 Proteins
  20354 (Sema4d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema PSI ig Ig_3 DUF3891 Ig_5 I-set PSI_integrin
Motif
Other DBs
NCBI-GeneID: 20354
NCBI-ProteinID: NP_001268809
MGI: 109244
Ensembl: ENSMUSG00000021451
Vega: OTTMUSG00000020953
UniProt: O09126
Position
13; 13 A5
AA seq 861 aa AA seqDB search
MRMCAPVRGLFLALVVVLRTAVAFAPVPRLTWEHGEVGLVQFHKPGIFNYSALLMSEDKD
TLYVGAREAVFAVNALNISEKQHEVYWKVSEDKKSKCAEKGKSKQTECLNYIRVLQPLSS
TSLYVCGTNAFQPTCDHLNLTSFKFLGKSEDGKGRCPFDPAHSYTSVMVGGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIQKSPDGPEGEDDKVYFFFTEVSV
EYEFVFKLMIPRVARVCKGDQGGLRTLQKKWTSFLKARLICSKPDSGLVFNILQDVFVLR
APGLKEPVFYAVFTPQLNNVGLSAVCAYTLATVEAVFSRGKYMQSATVEQSHTKWVRYNG
PVPTPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPKLIKKDVNY
TQIVVDRTQALDGTFYDVMFISTDRGALHKAVILTKEVHVIEETQLFRDSEPVLTLLLSS
KKGRKFVYAGSNSGVVQAPLAFCEKHGSCEDCVLARDPYCAWSPAIKACVTLHQEEASSR
GWIQDMSGDTSSCLDKSKESFNQHFFKHGGTAELKCFQKSNLARVVWKFQNGELKAASPK
YGFVGRKHLLIFNLSDGDSGVYQCLSEERVRNKTVSQLLAKHVLEVKMVPRTPPSPTSED
AQTEGSKITSKMPVASTQGSSPPTPALWATSPRAATLPPKSSSGTSCEPKMVINTVPQLH
SEKTVYLKSSDNRLLMSLLLFIFVLFLCLFSYNCYKGYLPGQCLKFRSALLLGKKTPKSD
FSDLEQSVKETLVEPGSFSQQNGDHPKPALDTGYETEQDTITSKVPTDREDSQRIDELSA
RDKPFDVKCELKFADSDADGD
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgcccccgttagggggctgttcttggccctggtggtagtgttgagaacc
gcggtggcatttgcacctgtgcctcggctcacctgggaacatggagaggtaggtctggtg
cagtttcacaagccaggcatctttaactactcggccttgctgatgagtgaggacaaagac
actctgtatgtaggcgcccgggaagcagtctttgcagtgaatgcgctgaacatctctgag
aagcaacatgaggtatattggaaggtctctgaagacaaaaaatccaagtgtgcagagaag
gggaaatcaaagcagacggaatgcctaaactacattcgagtactacagccactaagcagc
acttccctctatgtgtgtgggaccaatgcgttccagcccacctgtgaccacctgaacttg
acatccttcaagtttctggggaaaagtgaagatggcaaaggaagatgccccttcgacccc
gcccacagctacacatcagtcatggttgggggcgagctctactctgggacgtcctataat
ttcttgggcagtgaacccatcatctctcgaaactcttcccacagtcccttgaggacggag
tatgccatcccgtggctgaacgagcctagcttcgtctttgctgacgtgatccagaaaagc
ccagatggtccggagggtgaagatgacaaggtctacttcttttttacggaggtatccgtg
gagtacgaattcgtcttcaagttgatgatcccgcgagttgccagggtgtgcaagggcgac
cagggcggcctgcggactttgcaaaaaaagtggacctccttcctaaaggccaggctgatc
tgctccaagccagacagtggcctggtcttcaacatacttcaggatgtgtttgtgctgagg
gccccgggcctcaaggagcctgtgttctatgcggtcttcaccccacagctgaacaatgtg
ggtctgtcagcggtgtgcgcctacacactggccacggtggaggcagtcttctcccgtgga
aagtacatgcagagtgccacagtggagcagtctcacaccaagtgggtgcgctacaatggc
ccagtgcccactccccgacctggagcgtgtatcgacagtgaggcccgggcagccaactac
accagctccttgaatctcccagacaaaacactgcagtttgtaaaagaccaccctttgatg
gatgactcagtgaccccgatagacaacagacccaagctgatcaaaaaagatgtaaactac
acccagatagtggtagacaggacccaggccctggatgggactttctacgacgtcatgttc
atcagcacagaccggggagctctgcataaagcagtcatcctcacaaaagaggtgcatgtc
atcgaggagacccaactcttccgggactctgaaccggtcctaactctgctgctatcgtca
aagaaggggaggaagtttgtctatgcaggctccaactctggagtggtccaagcgcccctg
gcattctgcgaaaagcacggtagctgtgaagactgtgtgttagcacgggacccctactgt
gcctggagcccagccatcaaggcctgtgttaccctgcaccaggaagaggcctccagcagg
ggctggattcaggacatgagcggtgacacatcctcatgcctggataagagtaaagaaagt
ttcaaccagcattttttcaagcacggcggcacagcggaactcaaatgtttccaaaagtcc
aacctagcccgggtggtatggaagttccagaatggcgagttgaaggccgcaagtcccaag
tacggctttgtgggcaggaagcacctgctcatcttcaacctgtcggacggagacagcggc
gtgtaccagtgcctgtcagaggaaagggtgaggaataaaacggtctcccagctgctggcc
aagcacgttctggaagtgaagatggtacctcggacccccccctcacctacctcagaggat
gctcagacagaaggtagtaagatcacatccaaaatgccggttgcatctacccaggggtcc
tctccccctaccccggctctgtgggcaacctcccccagagccgccaccctacctcccaag
tcctcctccggcacatcctgtgaaccaaagatggtcatcaacacggtcccccagctccac
tcagagaagacggtgtatctcaagtccagtgacaaccgcctgctcatgtctctcctcctc
ttcatctttgtcctcttcctctgcctcttttcctacaactgctacaagggctacctgccc
ggacagtgcttaaaattccgctcagccctgctgcttggaaagaaaacacccaagtcagac
ttctctgacctggagcagagtgtgaaggagacactggtcgagcctgggagcttctcccag
cagaacggcgaccaccccaagccagccctggatacgggctatgaaacggagcaggacacc
atcaccagcaaagtccccacggatcgtgaggactcgcaacggatcgatgaactctctgcc
cgggacaaaccgtttgatgtcaagtgtgaactgaagtttgcagattcggatgctgacggg
gactga

DBGET integrated database retrieval system