KEGG   Mus musculus (mouse): 20362
Entry
20362             CDS       T01002                                 

Gene name
Septin8, AW046166, Sepl, Sept8
Definition
(RefSeq) septin 8
  KO
K16939  septin 6/8/11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    20362 (Septin8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    20362 (Septin8)
   04147 Exosome [BR:mmu04147]
    20362 (Septin8)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     20362 (Septin8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   20362 (Septin8)
SSDB
Motif
Pfam: Septin MMR_HSR1 AAA_22 RsgA_GTPase AAA_16 Roc AAA_7 Ras AIG1 RNA_helicase ABC_tran AAA_24 AAA_23 IMD T2SSE DUF87 AAA_29
Other DBs
NCBI-GeneID: 20362
NCBI-ProteinID: NP_001239261
MGI: 894310
Ensembl: ENSMUSG00000018398
Vega: OTTMUSG00000005635
UniProt: Q8CHH9
Position
11 B1.3; 11 31.96 cM
AA seq 429 aa
MAATDLERVSNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTL
MNTLFNTTFETEEASHHEECVRLRPQTYDLQESNVHLKLTIVDAVGFGDQINKDDSYRPI
VDYIDAQFENYLQEELKIRRSLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVN
IIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVV
GSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELY
RRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELK
EKERELHEKFEHLKRIHQEEKRKVEEKRRELEEETNAFNCRKAAMEALQSQALHATSQQP
LRKDKDKKN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggcggccaccgacttggaacgcgtctcgaacgcagagcctgagccccggagcctgtcc
ctgggcggccatgttgggtttgacagcctccctgaccagctggtcagcaagtcagtcact
cagggcttcagcttcaacatactctgtgtgggcgaaactgggattggcaagtccacgcta
atgaacacactcttcaacacgacctttgagactgaagaagccagtcaccatgaagagtgt
gtgcgcctgcggcctcagacctatgacctccaagagagtaacgttcatctcaagctgacc
atcgtggatgctgtgggctttggcgatcagatcaataaggatgacagttacaggcccata
gttgactacatcgacgcgcagtttgaaaactatctgcaggaggagttgaagatccgccgt
tccctctttgactatcacgacacgaggatccatgtttgcctctacttcatcacgcccacc
gggcactccctgaagtccctggatctggtgaccatgaagaaactagatagcaaggtgaat
ataatccccatcattgccaaggctgacaccatctccaagagcgagctccacaagttcaaa
atcaagatcatgggtgagctggtcagcaacggagtccagatctaccagtttcccaccgat
gacgaggctgtcgccgagattaatgcagtcatgaacgcacacctgccttttgccgtggtg
ggcagcacagaggaggtgaaggtggggaataagctggttcgagcacgacagtacccttgg
ggtgtggtgcaggtggagaatgagaatcactgtgacttcgtgaagctgcgggagatgctg
atccgggtgaacatggaggacctgcgcgagcagacccacagccggcactacgagctctac
cgccgctgcaagttggaggagatgggcttccaggacagtgacggtgacagccagcccttc
agcctccaagagacatatgaggcaaagaggaaggagttcctaagcgagctgcagaggaag
gaggaagagatgcgacagatgtttgtcaacaaagtcaaggagacagagcttgagctgaag
gagaaggaacgggagctccatgagaagtttgagcacctgaagcgaatccaccaggaggag
aagcgcaaggtagaggagaagcgcagggagctggaagaggagaccaacgccttcaactgc
cggaaggcggccatggaggccctgcagtcacaggccttgcatgccacttcacagcagcct
ctgaggaaagacaaggacaagaagaattaa

DBGET integrated database retrieval system