KEGG   Mus musculus (mouse): 20378Help
Entry
20378             CDS       T01002                                 

Gene name
Frzb, Frp, Sfrp3, frezzled, fritz, frzb-1
Definition
(RefSeq) frizzled-related protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Fz NTR
Motif
Other DBs
NCBI-GeneID: 20378
NCBI-ProteinID: NP_035486
MGI: 892032
Ensembl: ENSMUSG00000027004
Vega: OTTMUSG00000013372
UniProt: P97401
Structure
PDB: 

Position
2 C3; 2 48.13 cM
AA seq 323 aa AA seqDB search
MVCCGPGRMLLGWAGLLVLAALCLLQVPGAQAAACEPVRIPLCKSLPWNMTKMPNHLHHS
TQANAILAMEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE
PILIKYRHSWPESLACDELPVYDRGVCISPEAIVTADGADFPMDSSTGHCRGASSERCKC
KPVRATQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEILKASLVNIPRDTVNLYTT
SGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLGK
TDASDSTQNQKSGRNSNPRPARS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtctgctgcggcccgggacggatgctgctaggatgggccgggttgctagtcctggct
gctctctgcctgctccaggtgcccggagctcaggctgcagcctgtgagcctgtccgcatc
ccgctgtgcaagtcccttccctggaacatgaccaagatgcccaaccacctgcaccacagc
acccaggctaacgccatcctggccatggaacagttcgaagggctgctgggcacccactgc
agcccggatcttctcttcttcctctgtgcaatgtacgcacccatttgcaccatcgacttc
cagcacgagcccatcaagccctgcaagtctgtgtgtgagcgcgcccgacagggctgcgag
cccattctcatcaagtaccgccactcgtggccggaaagcttggcctgcgacgagctgccg
gtgtacgaccgcggcgtgtgcatctctcctgaggccatcgtcaccgcggacggagcggat
tttcctatggattcaagtactggacactgcagaggggcaagcagcgaacgttgcaaatgt
aagcctgtcagagctacacagaagacctatttccggaacaattacaactatgtcatccgg
gctaaagttaaagaggtaaagatgaaatgtcatgatgtgaccgccgttgtggaagtgaag
gaaattctaaaggcatcactggtaaacattccaagggacaccgtcaatctttataccacc
tctggctgcctctgtcctccacttactgtcaatgaggaatatgtcatcatgggctatgaa
gacgaggaacgttccaggttactcttggtagaaggctctatagctgagaagtggaaggat
cggcttggtaagaaagtcaagcgctgggatatgaaactccgacaccttggactgggtaaa
actgatgctagcgattccactcagaatcagaagtctggcaggaactctaatccccggcca
gcacgcagctaa

DBGET integrated database retrieval system