KEGG   Mus musculus (mouse): 20383Help
Entry
20383             CDS       T01002                                 

Gene name
Srsf3, AL024116, Sfrs3, X16
Definition
(RefSeq) serine and arginine-rich splicing factor 3
  KO
K12892  splicing factor, arginine/serine-rich 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    20383 (Srsf3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    20383 (Srsf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    20383 (Srsf3)
Spliceosome [BR:mmu03041]
 Common components
  Common spliceosomal components
   SR proteins
    20383 (Srsf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 20383
NCBI-ProteinID: NP_038691
MGI: 98285
Ensembl: ENSMUSG00000071172
Vega: OTTMUSG00000031658
UniProt: P84104
Position
17 A3.3; 17 15.03 cM
AA seq 164 aa AA seqDB search
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAA
DAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS
FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtgattcctgtcccttggattgtaaggtttatgtaggtaatcttggaaataat
ggaaacaagactgaattagaacgggcttttggctattatggaccactcagaagtgtgtgg
gttgctcgaaaccctcctggctttgctttcgtcgaatttgaggatccccgagatgctgct
gatgctgtccgggaactagatggaagaacactgtgtggctgccgtgtaagagtggaactg
tcgaatggtgaaaagagaagtcggaatcgtgggccgcctccctcttggggtcgtcgtcct
cgagatgattaccgcaggaggagtcctccacctcggcgcagatccccaagaaggagaagc
ttttcccgaagccggagcaggtcactttctagagataggagaagagaaaggtctctgtct
cgtgagagaaatcacaagccgtctcgatccttctctaggtctcgtagccgatctaggtca
aatgaaaggaaatag

DBGET integrated database retrieval system