KEGG   Mus musculus (mouse): 20384Help
Entry
20384             CDS       T01002                                 

Gene name
Srsf5, Sfrs5
Definition
(RefSeq) serine/arginine-rich splicing factor 5
  KO
K12893  splicing factor, arginine/serine-rich 4/5/6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
mmu05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    20384 (Srsf5)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    20384 (Srsf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    20384 (Srsf5)
Spliceosome [BR:mmu03041]
 Common components
  Common spliceosomal components
   SR proteins
    20384 (Srsf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_3 Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 20384
NCBI-ProteinID: NP_001073162
MGI: 98287
Ensembl: ENSMUSG00000021134
Vega: OTTMUSG00000021161
UniProt: O35326
Position
12; 12 C3
AA seq 269 aa AA seqDB search
MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGK
ELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVS
WQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGS
KRHRSRSRSRSRTRSSSRSRSRSRSRRSKSYSRSRSRSRSRSKSRSGSRSPVPEKSQKRG
SSSRSKSPASVDRQRSRSRSRSRSVDSGN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctgtcgagtgttcattgggagactaaatccagcagcgagggagaaagatgtg
gaaagattcttcaagggttacggacggatccgagatattgacttgaaaagaggttttggt
tttgtggaatttgaggacccaagggatgcagatgatgctgtttatgaacttgatgggaag
gaactttgcagtgaaagggtgacgattgaacatgcccgggctcggtctcgaggtggaaga
ggtagaggacgatactccgaccgttttagcagtcgcagacctcgaaatgatagacgaaat
gctccacctgtaagaacagaaaatcgacttatagttgagaatttatcctcaagagtcagc
tggcaggatctcaaagatttcatgagacaagctggggaagtaacctttgcggatgcacat
cgacctaaactaaatgaaggggtagttgagtttgcctcttatggtgacttaaagaatgct
attgagaaactttctggaaaggaaattaacgggagaaaaatcaaattaattgaaggcagc
aaaaggcacaggtcaagaagcaggtcacgatctcggaccagaagttcctctaggtcccgt
agccgatcccgttcacgaaggagcaagtcttacagccgatcaaggagcaggagccggagc
cggagcaagtcccgttctggtagtaggtctcctgtgcctgagaagagccagaaacgtggt
tcttcgagtagatctaaatctccagcatctgtggatcgccagaggtcccgatcccggtcc
aggtccagatcagttgacagtggcaattaa

DBGET integrated database retrieval system