KEGG   Mus musculus (mouse): 20393
Entry
20393             CDS       T01002                                 

Gene name
Sgk1, Sg, Sgk
Definition
(RefSeq) serum/glucocorticoid regulated kinase 1
  KO
K13302  serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    20393 (Sgk1)
   04151 PI3K-Akt signaling pathway
    20393 (Sgk1)
   04150 mTOR signaling pathway
    20393 (Sgk1)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    20393 (Sgk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20393 (Sgk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20393 (Sgk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   20393 (Sgk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C ABC1 Kdo APH
Other DBs
NCBI-GeneID: 20393
NCBI-ProteinID: NP_035491
MGI: 1340062
Ensembl: ENSMUSG00000019970
Vega: OTTMUSG00000031274
UniProt: Q9WVC6
Position
10; 10 A3
AA seq 431 aa
MTVKAEAARSTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIASNTYACKHAEVQSILKM
SHPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
EVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTD
FGLCKENIEHNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHIFFSLINW
DDLINKKITPPFNPNVSGPSDLRHFDPEFTEEPVPSSIGRSPDSILVTASVKEAAEAFLG
FSYAPPVDSFL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgaccgtcaaagccgaggctgctcgaagcacccttacctactccagaatgaggggaatg
gtagcgattctcatcgcttttatgaaacagagaaggatgggcctgaacgattttattcag
aagattgccagcaacacctatgcatgcaaacacgctgaagttcagtccattttgaaaatg
tcccatcctcaggagccggagcttatgaacgctaacccctctcctccgccaagtccctct
caacaaatcaacctgggtccgtcctccaaccctcacgccaaaccctccgactttcacttc
ttgaaagtgatcggaaagggcagttttggaaaggttcttctggctaggcacaaggcagaa
gaagtattctatgcagtcaaagttttacagaagaaagccatcctgaagaagaaagaggag
aagcatattatgtcagagcggaatgttctgttgaagaatgtgaagcaccctttcctggtg
ggccttcacttctcattccagaccgctgacaagctctactttgtcctggactacattaat
ggtggagagctgttctaccatctccagagggagcgctgcttcctggaaccacgggctcga
ttctacgcagctgaaatagccagtgccctgggctatctgcactccctaaacatcgtttat
agagacttaaaacctgagaatattctcctagactcccaggggcacatcgtcctcactgac
tttgggctctgcaaagagaatattgagcataacgggacaacatctaccttctgtggcacg
cctgagtatctggctcctgaggtcctccataagcagccgtatgaccggacggtggactgg
tggtgtcttggggctgtcctgtatgagatgctctacggcctgcccccgttttatagccgg
aacacggctgagatgtacgacaatattctgaacaagcctctccagttgaaaccaaatatt
acaaactcggcaaggcacctcctggaaggcctcctgcagaaggaccggaccaagaggctg
ggtgccaaggatgactttatggagattaagagtcatattttcttctctttaattaactgg
gatgatctcatcaataagaagattacacccccatttaacccaaatgtgagtgggcccagt
gaccttcggcacttcgatcccgagtttaccgaggagccggtccccagctccatcggcagg
tcccctgacagcatccttgtcacggccagtgtgaaggaagcagcagaagccttcctcggc
ttctcctatgcacctcctgtggattccttcctctga

DBGET integrated database retrieval system