KEGG   Mus musculus (mouse): 20399
Entry
20399             CDS       T01002                                 

Symbol
Sh2b1, AI425885, C530001K22Rik, Irip, Psm, SH2-B, SH2-Bb, Sh2bpsm1, mKIAA1299
Name
(RefSeq) SH2B adaptor protein 1
  KO
K12459  SH2B adaptor protein 1/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    20399 (Sh2b1)
SSDB
Motif
Pfam: Phe_ZIP SH2 PH PI3K_rbd
Other DBs
NCBI-GeneID: 20399
NCBI-ProteinID: NP_001276467
MGI: 1201407
Ensembl: ENSMUSG00000030733
Vega: OTTMUSG00000058215
UniProt: Q91ZM2
Structure
PDB: 
2HDV 2HDX

Position
7 F3; 7 69.06 cM
AA seq 756 aa
MNGAPSPEDGVFPSPPALPPPPPPSWQEFCESHARAAALDLARRFRLYLASHPQYAEPGA
EAAFSGRFAELFLQHFEAEVARASGSLSPPVLAPLSPGVEIPPSHDLSLESCRVGGPLAV
LGPSRSSEDLAGPLPSSVPSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGAVDSPS
QAGPLETTSGPPVLGGNSNSNSSGGAGTVGRALANDGTSPGERWTHRFERLRLSRGGGTL
KDGAGMIQREELLSFMGAEEAAPDPAGVGRGGGAAGLTSGGGGQPQWQKCRLLLRSEGEG
GGGSRLEFFVPPKASRPRLSIPCSTITDVRTATALEMPDRENTFVVKVEGPSEYILETSD
ALHVKAWVSDIQECLSPGPCPAISPRPMTLPLAPGTSFFTKDNTDSLELPCLNHSESLPS
QDLLLGPSESNDRLSQGAYGGLSDRPSASFSPSSASIAASHFDSMELLPPELPPRIPIEE
GPPAGTVHPLSTPYPPLDTPEAATGSFLFQGESEGGEGDQPLSGYPWFHGMLSRLKAAQL
VLEGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDM
LEHFRVHPIPLESGGSSDVVLVSYVPSQRQQERSTSRDPAQPSEPPPWTDPPHPGAEEAS
GAPEVAAATAAAAKERQEKEKAGSGGVQEELVPVAELVPMVELEEAIAPGTEAQGGAGSS
GDLEVSLMVQLQQLPLGGNGEEGGHPRAINNQYSFV
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgaatggtgccccttccccagaggatggggtcttcccttctccgccagcgctgccacca
ccccctcccccaagttggcaagagttctgtgagtcccatgcgagggcagctgccctggat
cttgcccgacgttttcgcctctacctggcctcccacccacagtatgcagagccgggagca
gaggccgctttttctggccgttttgctgagctcttcctgcagcacttcgaagccgaggtg
gctcgggcctcgggctcactctccccacctgtcctggctccattgagccctggtgtggaa
atcccaccatcacacgacctgtcccttgagagctgcagggtgggtgggcccctagcagtg
ttgggcccttctcgatcttctgaggacctggctggcccccttccttcctcagtcccttcc
tctacaacatcctcaaagccaaagctcaagaagcgcttctccctccgctcagtgggccgt
tcagtcagaggctctgttcgaggcatcctgcagtggcggggtgccgttgactcgccctcc
caagctgggcctctggagaccacatccggccctccagttctaggtggaaacagcaactcc
aactcctcgggtggtgctgggacagttggtagggcattggctaatgatggcacatcccct
ggggagagatggactcatcgatttgagaggctgaggctaagtcgtggagggggaaccctg
aaagacggagcaggaatgatacagagagaagagctgctgagtttcatgggggctgaagag
gctgcccctgacccagcaggagtgggtcgtggaggaggggcagctgggctgacctcagga
ggaggagggcagcctcagtggcaaaagtgtcgcttactgctccggagtgaaggagaagga
ggaggaggaagtcgcttggagttctttgtaccacccaaggcgtcccgaccccgtctcagc
attccctgctctactattactgatgtccgcacagccacagccctagagatgcctgacagg
gagaacacgtttgtggttaaggtagaaggcccttcagagtacatcctggagacaagtgat
gcgcttcatgtgaaggcctgggtgtctgacatccaggaatgcctaagccccggaccctgt
cctgctatcagcccccgtcccatgacccttcccctggcccctgggacctccttcttcaca
aaggataacacagacagcctggagttgccctgcctgaatcattcagagagtctgcctagc
caggatctgctgctgggacccagcgagagtaacgaccgcctgtcgcagggagcttatggg
ggcctctcagaccggccatcggcgtccttctcccctagttctgcctccattgctgcctcc
cattttgattcgatggaactgcttcctccagaattgcctcctcgaattcccattgaggag
gggcctccagcagggacagttcatcccctctctaccccctaccctcccctggatactcca
gaagcagccacaggatcgttcctgttccaaggggagtcagaggggggtgagggggatcag
cccctctcaggctatccttggttccacggcatgctctctcgactcaaagctgcccagtta
gtgttagaaggaggcactggctcccatggtgtcttcttggtacgccagagtgagacaagg
cgtggtgaatatgtcctcactttcaacttccagggcaaggccaagcacctgcgcttgtca
ctaaatgaggagggacagtgccgggtccaacatctgtggttccagtccattttcgatatg
cttgagcacttccgggtgcaccccatccctctggagtctggaggctccagtgatgttgtc
cttgtcagctatgtgccctcccagcggcagcaggaacggagcacctcccgtgacccagcc
cagccctctgaaccccctccatggacagatcccccacatcctggggcagaagaggcgtcg
ggggcgccagaagttgcggcagccacagccgcagcagccaaagagaggcaagagaaagag
aaagcgggcagtggaggggtccaggaagagctggtccccgtggctgagctggtccccatg
gttgaattggaagaggccatagcaccaggcactgaggctcagggtggtgctggctctagt
ggggacttggaggtgtccctaatggtacagctccagcagctaccactagggggcaacgga
gaagaagggggtcacccccgagccattaataatcagtactcatttgtgtga

DBGET integrated database retrieval system