KEGG   Mus musculus (mouse): 20400
Entry
20400             CDS       T01002                                 

Gene name
Sh2d1a, Gm686, SAP
Definition
(RefSeq) SH2 domain containing 1A
  KO
K07990  SH2 domain-containing protein 1A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    20400 (Sh2d1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20400 (Sh2d1a)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   20400 (Sh2d1a)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 20400
NCBI-ProteinID: NP_035494
MGI: 1328352
Ensembl: ENSMUSG00000005696
Vega: OTTMUSG00000017466
UniProt: O88890 Q544F1
Position
X; X A4
AA seq 126 aa
MDAVTVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYQGYIYTYRVSQTE
TGSWSAETAPGVHKRFFRKVKNLISAFQKPDQGIVTPLQYPVEKSSGRGPQAPTGRRDSD
ICLNAP
NT seq 381 nt   +upstreamnt  +downstreamnt
atggatgcagtgactgtgtaccacggcaaaatcagcagggagaccggggagaagctctta
ctcgctaccgggctggatggaagctatctgctgcgagacagcgagagtgtccctggcgtg
tactgcctgtgtgttttgtatcaaggttacatctacacatatcgagtgtcccagacagaa
acaggttcttggagtgccgagacagcacctggagtacataaaagatttttccggaaagta
aaaaatctcatctcagcgtttcagaagccggatcaaggcatcgtgacgcctctgcagtat
ccagttgaaaagtcctctggcaggggcccacaagctcccacagggagaagagattctgat
atctgcctgaatgcaccatga

DBGET integrated database retrieval system