KEGG   Mus musculus (mouse): 20403Help
Entry
20403             CDS       T01002                                 

Gene name
Itsn2, AI327390, Ese2, Sh3d1B, Sh3p18, mKIAA1256
Definition
(RefSeq) intersectin 2
  KO
K20045  intersectin
Organism
mmu  Mus musculus (mouse)
Brite
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    20403 (Itsn2)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    20403 (Itsn2)
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    20403 (Itsn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH_13 SH3_9 SH3_1 SH3_2 RhoGEF EF-hand_4 C2 EF-hand_1 EF-hand_6 EF-hand_7 PH
Motif
Other DBs
NCBI-GeneID: 20403
NCBI-ProteinID: NP_001185897
MGI: 1338049
Ensembl: ENSMUSG00000020640
UniProt: B2RR82
Position
12; 12 A1.1
AA seq 1685 aa AA seqDB search
MMAQFPTAMNGGPNMWAITSEERTKHDKQFDNLKPSGGYITGDQARTFFLQSGLPAPVLA
EIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMG
SMPNLSIHQPLPPVAPIATPLSSATSGTSIPPLMMPAPLVPSVSTSSLPNGTASLIQPLS
IPYSSSTLPHASSYSLMMGGFGGASIQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEWA
VPQPSRLKYRQKFNSLDKGMSGYLSGFQARNALLQSNLSQTQLATIWTLADIDGDGQLKA
EEFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQVDSVNGTLPSYQKTQEEEPQKKL
PVTFEDKRKANYERGNMELEKRRQVLMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQ
LELEKRLEKQRELERQREEERRKEIERREAAKQELERQRRLEWERLRRQELLSQKTREQE
DIVRLSSRKKSLHLELEAVNGKHQQISGRLQDVQIRKQTQKTELEVLDKQCDLEIMEIKQ
LQQELKEYQNKLIYLVPEKQLLNERIKNMQLSNTPDSGISLLHKKSSEKEELCQRLKEQL
DALEKETASKLSEMDSFNNQLKCGSMDDCVLQCLLSLLSCLNNLFLLLKELRESYNTQQL
ALEQLHKIKRDKLKEIERKRLEQIQKKKLEDEAARKAKQGKENLWRESIRKEEEEKQKRL
QEEKSQDKTQEEERKAEAKQSETASALVNYRALYPFEARNHDEMSFSSGDIIQVDEKTVG
EPGWLYGSFQGKFGWFPCNYVEKVLSSEKALSPKKALLPPTVSLSATSTSSQPPASVTDY
HNVSFSNLTVNTTWQQKSAFTRTVSPGSVSPIHGQGQAVENLKAQALCSWTAKKENHLNF
SKHDVITVLEQQENWWFGEVHGGRGWFPKSYVKLIPGNEVQRGEPEALYAAVTKKPTSTA
YPVTSTAYPVGEDYIALYSYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGERTGIFPSN
YVRPKDQENFGNASKSGASNKKPEIAQVTSAYAASGTEQLSLAPGQLILILKKNTSGWWQ
GELQARGKKRQKGWFPASHVKLLGPSSERTMPTFHAVCQVIAMYDYMANNEDELNFSKGQ
LINVMNKDDPDWWQGETNGLTGLFPSNYVKMTTDSDPSQQWCADLQALDTMQPTERKRQG
YIHELIQTEERYMDDLQLVIEVFQKRMAESGFLTEADMALIFVNWKELIMSNTKLLRALR
VRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGATLLQQKTDEDTDFKEFLKKL
ASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPQSHVDHSSLKLALERAEELCSQV
NEGVREKENSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKLYKTKSNKELHA
FLFNDFLLLTYLVRQFAAASGHEKLFNSKSSAQFRMYKTPIFLNEVLVKLPTDPSSDEPV
FHISHIDRVYTLRTDNINERTAWVQKIKGASEQYIDTEKKKREKAYQARSQKTSGIGRLM
VHVIEATELKACKPNGKSNPYCEVSMGSQSYTTRTLQDTLNPKWNFNCQFFIKDLYQDVL
CLTMFDRDQFSPDDFLGRTEVPVAKIRTEQESKGPTTRRLLLHEVPTGEVWVRFDLQLFE
QKTLL
NT seq 5058 nt NT seq  +upstreamnt  +downstreamnt
atgatggctcagtttcccacagcgatgaatggagggccaaatatgtgggctattacatct
gaagaacgtactaagcatgataaacagtttgataacctcaaaccttcaggaggttacata
acaggtgatcaagcccgtacttttttcctacagtcaggtctgccggccccggttttagct
gaaatatgggccttatcagatctgaacaaggatgggaagatggaccagcaagagttctct
atagctatgaaactcatcaagttaaagttgcagggccaacagctgcctgtagtcctccct
cctatcatgaaacaaccccctatgttctctccactaatctctgctcgttttgggatggga
agcatgcccaatctgtccattcatcagccattgcctccagttgcacctatagcaacaccc
ttgtcttctgctacttcagggaccagtattcctcccctaatgatgcctgctcccctagtg
ccttctgttagtacatcctcattaccaaatggaactgccagtctcattcagcctttatcc
attccttattcttcttcaacattgcctcatgcatcatcttacagcctgatgatgggagga
tttggtggtgctagtatccagaaggcccagtctctgattgatttaggatctagtagctca
acttcctcaactgcttccctctcagggaactcacctaagacagggacctcagagtgggca
gttcctcagccttcaagattaaagtatcggcaaaaatttaatagtctagacaaaggcatg
agcggatacctctcaggttttcaagctagaaatgcccttcttcagtcaaatctctctcaa
actcagctagctactatttggactctggctgacatcgatggtgacggacagttgaaagct
gaagaatttattctggcgatgcacctcactgacatggccaaagctggacagccactacca
ctgacgttgcctcccgagcttgtccctccatctttcagagggggaaagcaagttgattct
gttaatggaactctgccttcatatcagaaaacacaagaagaagagcctcagaagaaactg
ccagttacttttgaggacaaacggaaagccaactatgaacgaggaaacatggagctggag
aagcgacgccaagtgttgatggagcagcagcagagggaggctgaacgcaaagcccagaaa
gagaaggaagagtgggagcggaaacagagagaactgcaagagcaagaatggaagaagcag
ctggagttggagaaacgcttggagaaacagagagagctggagagacagcgggaggaagag
aggagaaaggagatagaaagacgagaggcagcaaaacaggagcttgagagacaacgccgt
ttagaatgggaaagactccgtcggcaggagctgctcagtcagaagaccagggaacaagaa
gacattgtcaggctgagctccagaaagaaaagtctccacctggaactggaagcagtgaat
ggaaaacatcagcagatctcaggcagactacaagatgtccaaatcagaaagcaaacacaa
aagactgagctagaagttttggataaacagtgtgacctggaaattatggaaatcaaacaa
cttcaacaagagcttaaggaatatcaaaataagcttatctatctggtccctgagaagcag
ctattaaacgaaagaattaaaaacatgcagctcagtaacacacctgattcagggatcagt
ttacttcataaaaagtcatcagaaaaggaagaattatgccaaagacttaaagaacaatta
gatgctcttgaaaaagaaactgcatctaagctctcagaaatggattcatttaacaatcag
ctgaagtgtgggagtatggatgactgtgtccttcagtgccttttgtctctgctgagctgt
ctcaacaacctcttcctcttacttaaggaactcagagaaagctataatacacagcagtta
gcccttgaacaacttcataaaatcaaacgtgacaaattgaaggaaatcgaaagaaaaaga
ttagagcaaattcaaaaaaagaaactagaagatgaggctgcaaggaaagcaaagcaagga
aaagaaaacttgtggagagaaagtattagaaaggaagaagaggaaaagcaaaaacgactc
caggaagaaaagtcacaggacaaaactcaagaagaggaacgaaaagctgaggcaaaacaa
agtgagacagccagtgctttggtgaattacagagcactgtacccttttgaagcaagaaac
catgatgagatgagttttagttctggggatataattcaggttgatgaaaaaactgtagga
gagcctggttggctttatggtagttttcagggaaagtttggctggttcccgtgcaactat
gtagaaaaagtgctgtcaagtgaaaaagctctgtctcctaagaaggccttacttcctcct
acagtgtctctctctgctacctcaacttcttcccagccaccagcatcagtgactgattat
cacaatgtatccttctcaaaccttactgttaatacaacatggcagcagaagtcagctttt
acccgcactgtgtcccctggatctgtgtcccccattcacggacaggggcaggctgtagaa
aacctgaaagcccaggccctttgttcctggacggcaaagaaggagaaccacctgaacttc
tcaaagcacgacgtcatcactgtcctggagcagcaggaaaactggtggtttggggaggtg
cacggaggaagaggatggttccccaagtcttatgtcaagctcattcctgggaatgaagta
cagcgaggagagccagaagctttgtatgcagctgtgactaagaaacctacctccacagcc
tatccagttacctccacagcctatccagttggagaagactacattgcactttattcatac
tcaagtgtagagcccggggatttgactttcactgaaggtgaagaaattctagtgacccag
aaagatggagagtggtggacaggaagtattggagagagaactggaatcttcccgtccaac
tacgtcagaccaaaggatcaagagaattttgggaatgctagcaaatctggagcatcaaac
aaaaaacccgagatcgctcaagtaacttcagcatatgctgcttcagggactgagcagctc
agccttgcgccaggacagttaatattaatcttaaagaaaaacacaagcgggtggtggcaa
ggagagctacaggccagagggaagaaacgacagaagggatggtttcctgccagccatgta
aagctgctaggtccaagcagtgaaagaaccatgcctacttttcacgctgtatgtcaagtg
attgctatgtatgactacatggcgaataacgaagatgagctcaatttctccaaaggacag
ctgattaatgttatgaacaaagatgaccctgactggtggcaaggagaaaccaatggtctg
actggtctctttccttcaaactatgttaagatgacaacagactcagatccaagtcaacag
tggtgtgctgacctccaagccctggacacaatgcagcctacggagaggaagcgacagggc
tacattcacgagctcattcagacagaggagcggtacatggacgacctgcagctggtcatc
gaggtcttccagaaacggatggctgagtcaggcttcctcactgaagcagacatggctctg
atctttgtgaactggaaagagctcatcatgtccaacacgaagctgctgagggccttgcgg
gtgaggaagaagactgggggtgagaagatgccagttcagatgattggagacatcctggcg
gcagagctgtcccacatgcaggcctacatccgcttctgcagctgtcagcttaatggggca
accctgttacagcagaagacagacgaggacacggacttcaaggaatttctaaagaagttg
gcatcagacccacgatgcaaagggatgcccctctccagcttcctgctgaagcccatgcag
aggatcactcgctacccgctgctcatccgaagtatcctggagaacactccacagagtcat
gttgaccactcctccctgaagctggccctagaacgtgctgaggagctgtgctctcaggtg
aacgagggagtccgggagaaggaaaattcagaccggctggagtggatccaggcacacgtg
cagtgcgaaggcttggcagagcaacttattttcaactccctcaccaactgcctgggcccc
cggaagcttctgcacagcgggaagctgtacaagaccaagagcaataaggagctgcacgcc
ttcctcttcaacgacttcctgctgctcacctacctggtcaggcagtttgccgccgcctct
ggccacgagaagctcttcaactccaagtccagtgctcagttccggatgtacaaaacgccc
attttcctgaatgaagtgttggtgaaacttcccacagacccttccagcgatgagcccgtc
ttccacatttcccacattgatcgtgtgtacacactccgaacagacaacatcaacgagagg
acggcctgggtccagaagatcaagggtgcctcagagcagtacatcgacactgagaagaag
aaacgggaaaaggcttaccaagcccgttctcaaaagacttcaggtattgggcgtctgatg
gtgcatgtcattgaagctacagaattaaaagcctgcaaaccaaacgggaaaagtaatcca
tactgtgaagtcagcatgggctcccaaagctataccaccaggaccctgcaggacacacta
aaccccaagtggaacttcaactgccagttcttcatcaaggatctttaccaggacgttctg
tgtctcactatgtttgacagagaccagttttctccagatgacttcttgggtcgtactgaa
gttccagtggcaaaaatccgaacagaacaggaaagcaaaggccccaccacccgccgacta
ctactgcacgaagtccccactggagaagtctgggtccgctttgacctgcaactttttgaa
caaaaaactctcctttga

DBGET integrated database retrieval system