KEGG   Mus musculus (mouse): 20404Help
Entry
20404             CDS       T01002                                 

Gene name
Sh3gl2, 9530001L19Rik, AI120490, AW555077, B930049H17Rik, EEN-B1, SH3PA, Sh3d2a
Definition
(RefSeq) SH3-domain GRB2-like 2
  KO
K11247  endophilin-A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    20404 (Sh3gl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20404 (Sh3gl2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    20404 (Sh3gl2)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    20404 (Sh3gl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR SH3_1 SH3_2 SH3_9 BAR_2 BAR_3 DNA_pol_B_2 Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 20404
NCBI-ProteinID: NP_062408
MGI: 700009
Ensembl: ENSMUSG00000028488
Vega: OTTMUSG00000007959
UniProt: Q62420
Structure
PDB: 

Position
4 C4; 4 40.23 cM
AA seq 352 aa AA seqDB search
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
MRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL
EERIRQASSQPRREYQPKPRMSLEFATGDSTQPNGGLSHTGTPKPPGVQMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggcagggctgaagaagcagttccacaaagccactcagaaagtgagtgagaag
gtgggaggagcggaaggcaccaagctcgatgatgacttcaaagagatggagaggaaagtg
gatgtcaccagcagggctgtgatggagataatgacaaaaacgattgaatacctccaaccc
aatccagcttccagggctaagctcagtatgatcaacaccatgtcgaaaatccgcggccaa
gagaaggggccaggctaccctcaggcggaagcactgctggcagaggccatgctcaagttc
ggcagggagctgggtgatgattgcaactttggtcctgctctcggtgaggtgggagaagcc
atgagggagctctcggaggtcaaggactcattggacatggaagtgaagcagaatttcatc
gacccccttcagaatcttcatgacaaggatctgagggagattcagcatcatctgaaaaag
ctggaaggccgacgcttagactttgattataagaagaagcgacaaggcaagattccagat
gaagaactccgccaagctctggagaaattcgatgagtctaaagaaatcgccgagtcgagc
atgttcaacctcttggagatggatatagaacaggtgagccagctctccgcacttgttcag
gctcagctggagtaccacaagcaggcagtgcagatcctgcagcaggtcactgtcagactg
gaagaaagaataagacaagcttcatctcagccaagaagggaatatcagcccaaaccacgg
atgagcctagagtttgccactggagacagtactcagcccaacgggggtctctcccacaca
ggcacacccaaacctccaggtgtccaaatggatcagccctgctgccgagctctgtatgac
tttgaacctgaaaatgaaggggaattgggttttaaagagggcgatatcatcacactcact
aatcagattgacgagaactggtatgaggggatgcttcatggccagtctggctttttcccc
atcaactatgtagaaattctggttgctctgccccattag

DBGET integrated database retrieval system