KEGG   Mus musculus (mouse): 20416
Entry
20416             CDS       T01002                                 

Gene name
Shc1, Shc, ShcA, p66, p66shc
Definition
(RefSeq) src homology 2 domain-containing transforming protein C1
  KO
K06279  SHC-transforming protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04510  Focal adhesion
mmu04650  Natural killer cell mediated cytotoxicity
mmu04722  Neurotrophin signaling pathway
mmu04910  Insulin signaling pathway
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
mmu05034  Alcoholism
mmu05100  Bacterial invasion of epithelial cells
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05220  Chronic myeloid leukemia
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    20416 (Shc1)
   04012 ErbB signaling pathway
    20416 (Shc1)
   04072 Phospholipase D signaling pathway
    20416 (Shc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    20416 (Shc1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    20416 (Shc1)
   04062 Chemokine signaling pathway
    20416 (Shc1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    20416 (Shc1)
   04915 Estrogen signaling pathway
    20416 (Shc1)
   04917 Prolactin signaling pathway
    20416 (Shc1)
   04926 Relaxin signaling pathway
    20416 (Shc1)
   04935 Growth hormone synthesis, secretion and action
    20416 (Shc1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    20416 (Shc1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    20416 (Shc1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    20416 (Shc1)
   05226 Gastric cancer
    20416 (Shc1)
   05214 Glioma
    20416 (Shc1)
   05220 Chronic myeloid leukemia
    20416 (Shc1)
   05224 Breast cancer
    20416 (Shc1)
  09165 Substance dependence
   05034 Alcoholism
    20416 (Shc1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    20416 (Shc1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    20416 (Shc1)
   01522 Endocrine resistance
    20416 (Shc1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 20416
NCBI-ProteinID: NP_001106802
MGI: 98296
Ensembl: ENSMUSG00000042626
Vega: OTTMUSG00000022071
UniProt: P98083
Position
3 F1; 3 39.11 cM
AA seq 579 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRLGPKGEPGKAAEDGEGSAGAALRDSGLLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAARPTLPSAQMSSHLGATLPIGQHAAGDHEVRKQMLPPPPCPGRELFDD
PSYVNIQNLDKARQAGGGAGPPNPSLNGSAPRDLFDMKPFEDALRVPPPPQSMSMAEQLQ
GEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRT
KDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVDRKV
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggatcttctaccccccaagccgaagtacaacccacttcggaatgagtctctgtcatcg
ctggaggagggggcttcggggtctacccctccggaggagctaccttccccatcagcttca
tccctgggacccattctgcctcctctgccgggggacgatagtccgactaccctgtgttcc
ttctttccccggatgagcaacctgaagctggccaatcctgctggggggcgcctggggcct
aaaggggagccaggaaaggctgctgaagatggggaagggagtgcaggggcagcccttcgg
gactcaggcctcttgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtagaagggggccagctggggggcgaggagtggaccagacacgggagcttt
gtcaataagcccacacgaggctggctgcatcccaacgacaaagtcatgggacctggggtt
tcctacttggttcggtacatgggctgtgtggaggtcttacagtcaatgcgagcccttgac
ttcaatacccggactcaggtcaccagggaggccatcagtttggtgtgtgaagctgtgcct
ggtgccaaaggggcgacaaggaggagaaagccttgtagccgcccactcagctccatcctg
gggaggagtaacctgaagtttgctggaatgccaatcactctcactgtgtctaccagcagc
cttaacctcatggcagccgactgcaaacagatcattgccaaccatcacatgcaatctatc
tctttcgcgtccggtggggatccggacacagctgagtatgttgcctatgttgccaaagac
cctgtgaatcagagagcctgccatatcctggagtgtcctgaagggcttgctcaggatgtc
atcagcaccatcgggcaggcctttgagttgcgcttcaaacagtatctcaggaatccaccg
aagctggtcaccccccatgacaggatggctggctttgatggctcagcttgggatgaggag
gaagaagagccccctgaccatcagtactacaatgactttccagggaaggaaccccctctt
ggtggggtggtagatatgaggcttcgggaaggggctgctcgacccactctgcctagtgcc
cagatgtccagccacttgggagctacactgcctatagggcagcatgctgcaggagaccat
gaagtccgtaaacagatgttgcctccgccgccttgcccaggcagagaactcttcgatgac
ccctcctatgtcaacatccagaatctagacaaggcccggcaggctgggggtggggctggg
cccccaaatccttctcttaatggcagtgcaccccgagacctttttgacatgaagcccttt
gaagatgcacttcgggtgccacccccaccgcagtccatgtccatggctgagcagctgcaa
ggggagccctggttccacgggaagctgagccggagggaggccgaggcgctgctgcagctc
aatggtgacttcttggtgcgagagagcacgaccacgcctggccagtatgtgctcactggc
ctgcagagtgggcagcccaagcacttgctgctggtggaccctgaaggtgtggttcggaca
aaggatcaccgctttgagagtgtcagtcacctgatcagctaccacatggacaatcacttg
cccatcatctctgcgggcagcgaactgtgcctacagcaacccgtggatcggaaagtgtga

DBGET integrated database retrieval system