KEGG   Mus musculus (mouse): 20430
Entry
20430             CDS       T01002                                 

Gene name
Cyfip1, E030028J09Rik, P140SRA-1, P140sra1, Shyc, Sra-1, Sra1, l(7)1Rl, l71Rl, l7Rl1, mKIAA0068, pl-1
Definition
(RefSeq) cytoplasmic FMR1 interacting protein 1
  KO
K05749  cytoplasmic FMR1 interacting protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    20430 (Cyfip1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    20430 (Cyfip1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    20430 (Cyfip1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    20430 (Cyfip1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     20430 (Cyfip1)
   Factors involved in mRNA localization
    Other mRNA localization factors
     20430 (Cyfip1)
SSDB
Motif
Pfam: FragX_IP DUF1394 BP28CT zf-CW
Other DBs
NCBI-GeneID: 20430
NCBI-ProteinID: NP_001158133
MGI: 1338801
Ensembl: ENSMUSG00000030447
Vega: OTTMUSG00000037588
UniProt: Q7TMB8
Position
7; 7 B5
AA seq 1253 aa
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLAD
IVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCASSSSSPQYNICEQMIQIREDHMRFI
SELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPT
DKYSNKDCPDNAEEYERATRYNYTTEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTV
YAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPK
SGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESF
FYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASM
MEYVLYSLDLYNDSAHYALTKFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGS
LLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSL
ELAIGRFESEDLTSVVELDGLLEINRMTHKLLSRYLTLDSFDAMFREANHNVSAPYGRIT
LHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSS
IYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKIC
RLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAVLFCLLIEQSLSLEEVC
DLLHAAPFQNILPRIHVKEGERVDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDL
LTKERLCCGLSMFEVILTRIRTFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCI
PVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVP
LKKMVERIRKFQILNDEIITILDKYLKSGDGESTPVEHVRCFQPPIHQSLASS
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggctgcccaagtgacactagaggacgcactgtccaatgtggacctcctggaggagctg
cctctgcctgaccagcagccctgcatcgagcccccaccgtcctcgctgctctatcagcca
aatttcaacaccaactttgaagacagaaatgcatttgtcactggcattgcaagatacatc
gaacaagcaactgtccactctagcatgaacgagatgctagaggaaggccaagagtatgct
gtcatgctgtacacctggaggagctgctcccgggccatccctcaggtgaagtgcaacgag
cagccgaatagagttgaaatttatgagaaaaccgtggaagtccttgaacccgaggtcaca
aaactgatgaattttatgtactttcagagaaatgccatcgagcggttctgtggggaagtg
agacgcctgtgtcatgctgagaggagaaaggactttgtttctgaagcctacttgatcacc
ctgggcaaatttatcaacatgtttgctgtgttggatgagctgaagaacatgaagtgcagt
gtgaagaatgaccactctgcatataagagggctgctcagtttttacgtaaaatggcagat
ccacaatccatccaggagtcacagaatctgtccatgttcctggccaaccacaacaagatt
acacaatctctgcagcagcagcttgaggtcatttctggctatgaagagctcctggcagac
atcgtgaatctgtgtgtggattactatgagaacaggatgtacttgacacccagcgaaaaa
cacatgcttctcaaagtcatgggatttggcctgtacctgatggatgggagtgtgagtaac
atctacaaactagatgccaagaaaagaataaatttatccaaaatcgacaagtatttcaag
cagctgcaggtggttccactctttggagatatgcaaatagaactggcaagatacatcaag
accagcgcacactatgaggagaataagtcccggtggacctgcgcgtcctccagcagcagc
ccgcagtacaacatctgtgagcagatgatccagatccgtgaggaccatatgcgtttcatc
tccgagctggcacgctacagcaatagcgaggtagtcacagggtctggccggcaggaagcc
cagaagacagatgctgagtaccggaagctcttcgatctggctctgcagggcctgcagctt
ctgtcgcagtggagcgctcacgtgatggaagtgtattcctggaaacttgtacatccaaca
gacaagtactccaacaaggactgccccgacaacgctgaggagtacgagcgagccacacgc
tacaactacaccactgaggagaagtttgccctggtggaggtgattgccatgatcaaaggc
ctgcaggtgctgatgggcaggatggagagtgtgttcaatcacgccatcagacacacggtt
tacgctgcgcttcaggacttctcccaggtgaccctcagggaaccactgcgacaggccatc
aagaagaaaaagaacgtaatccagagtgtcctacaggccatcaggaagactgtgtgtgac
tgggagactgggcatgagccctttaacgacccagctctgcggggagagaaggaccctaag
agtggctttgacatcaaggtgccacgccgtgctgtgggaccctccagcacgcagctttac
atggtgagaactatgctagagtccctcattgcagacaaaagtggttccaagaaaaccttg
agaagtagccttgaggggcccaccatattggacatagaaaaatttcatcgagaatcattc
ttctacactcacttgataaatttcagtgaaacactgcagcagtgctgtgacctttcccag
ctgtggttccgagagttcttcctggagctgaccatgggcaggaggatccagttccccatt
gagatgtctatgccctggattctgactgaccacatcctagagaccaaggaggcatcaatg
atggagtacgtcctctactccttggacctgtacaacgacagtgcccactatgcgctcacc
aagttcaacaagcagtttctctatgatgagattgaggcagaggtgaatctgtgttttgac
caatttgtttataaactagcagaccagatatttgcatattacaaggttatggcaggaagt
ttgcttcttgacaaaaggttacggtcagaatgcaaaaatcagggagccacgatccacctc
cccccatctaaccgctatgagacgctgttgaagcaaaggcacgtgcagctgctcgggaga
tccattgatctcaaccgtctgattacacagcgcgtttcagcagccatgtacaaatctcta
gaactggcaattggacggtttgaaagtgaagatttaacatcagtagtcgagctagatgga
ctcttagaaatcaaccgtatgacacacaagctgttgagcaggtacctcacactggacagc
tttgatgccatgttccgggaagccaaccacaacgtgtctgcaccttatggaagaattacc
ctccacgtcttctgggagctaaactatgacttcttgcccaactactgctataatggctct
accaaccggtttgttcggacagtattaccattttctcaggaatttcaaagagacaaacag
cctaacgcacagccccagtatttgcatggatccaaggctttgaacctagcctactcaagc
atttatggcagctaccggaactttgtggggcctccgcacttccaagtcatctgccggcta
cttggctaccagggcattgcagtagtcatggaagagctgctgaaggttgtcaagagcctg
ctgcaaggcacaatcctgcagtacgtgaaaactctgatggaagtgatgcccaagatctgc
cggcttccgcgacatgagtacggctctcctggcatcctggagttcttccaccaccagctg
aaggacattgtggagtatgcagagctgaaaaccgtatgcttccagaacctgcgggaggtg
ggcaatgctgttctcttctgcctgcttattgagcaaagcctgtctttagaagaagtctgt
gacctgttgcatgcagctcctttccagaatatcttacctcgaatccatgtaaaagagggg
gagagagttgatgccaaaatgaaaagactagaatccaagtatgccccactgcaccttgtc
ccactgattgaaaggctggggaccccacagcaaattgcaattgcaagagagggggacttg
ctaaccaaggagcgtctctgttgtggtctgtccatgtttgaagtcatcctgacacggatc
cggacctttctggatgatcccatctggcgtgggcccctacccagcaatggtgtcatgcac
gtggatgagtgtgtggagtttcacagactatggagtgccatgcagtttgtttactgcatt
cctgtagggacacacgagtttacagtggagcagtgttttggagatgggctccactgggct
ggctgcatgatcattgtacttcttggacagcagcggcgctttgctgtgttggatttctgc
tatcatcttctcaaagttcagaaacatgatggcaaagatgagatcatcaaaaatgtgcca
ttgaagaagatggtggagaggatccgcaagttccagattctcaacgatgaaatcatcact
atcctggacaagtacttgaaatctggtgatggcgagagcacacctgtggagcatgtacgc
tgcttccagccacccatccaccagtccctagccagtagctga

DBGET integrated database retrieval system