KEGG   Mus musculus (mouse): 20437Help
Entry
20437             CDS       T01002                                 

Gene name
Siah1a, AA982064, AI853500, Sinh1a
Definition
(RefSeq) siah E3 ubiquitin protein ligase 1A
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04115  p53 signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    20437 (Siah1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    20437 (Siah1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    20437 (Siah1a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     20437 (Siah1a)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    20437 (Siah1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sina
Motif
Other DBs
NCBI-GeneID: 20437
NCBI-ProteinID: NP_033198
MGI: 108064
Ensembl: ENSMUSG00000036840
Vega: OTTMUSG00000061427
UniProt: P61092
Structure
PDB: 

Position
8 C3; 8 42.1 cM
AA seq 282 aa AA seqDB search
MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHL
VCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEEL
CEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVM
MQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
RSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccagactgctacagcattacccactggcacctcaaagtgtccaccatcccag
agggtacctgccttgaccggcacaactgcatccaacaatgacttggcgagtctttttgag
tgtcctgtctgctttgactatgtgttgccacctattcttcagtgtcagagtggccatctt
gtttgtagcaactgtcgccccaaacttacatgttgtcccacttgccggggcccattggga
tccattcgcaacttggctatggagaaagtggccaactcagtactcttcccttgtaaatat
gcctcttctggatgtgaaataactctgccacacaccgaaaaggcagagcacgaggagctc
tgtgagttcaggccttactcctgcccctgccctggtgcttcctgtaagtggcaaggctcc
ttggatgccgtcatgccccacctgatgcatcagcacaagtccattaccaccctgcaagga
gaagatatagttttccttgctacagacattaaccttcctggtgctgttgactgggtgatg
atgcagtcttgttttggctttcatttcatgttagtcttggagaaacaagaaaaatatgat
ggtcatcagcagttctttgcaattgtacaactgataggaacacgcaagcaagctgaaaat
tttgcatatcgacttgagctaaatggtcataggcggcgattgacttgggaagcgactcct
cggtctattcatgagggaattgcaacagccattatgaatagtgactgcctagtgtttgac
accagcattgcacagctttttgcagaaaatggcaatttaggcatcaatgtaactatttcc
atgtgttga

DBGET integrated database retrieval system