KEGG   Mus musculus (house mouse): 20451
Entry
20451             CDS       T01002                                 
Symbol
St8sia3, AI847333, ST8SiaIII, Siat8c
Name
(RefSeq) ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3
  KO
K06613  alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8C) [EC:2.4.3.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    20451 (St8sia3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.3  Sialyltransferases
    2.4.3.-
     20451 (St8sia3)
Glycosyltransferases [BR:mmu01003]
 Terminal extension
  Sialyltransferase
   20451 (St8sia3)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 20451
NCBI-ProteinID: NP_033208
MGI: 106019
Ensembl: ENSMUSG00000056812
UniProt: Q64689 Q9CUJ6
Position
18:64387430..64409217
AA seq 380 aa
MRNCKMARVASVLGLVMLSVALLILSLISYVSLKKENIFTTPKYASPGAPRMYMFHAGFR
SQFALKFLDQSFVPITNSLTHELQEKPSKWTFNRTAFLHQRQEILQHVDVIKNFSLTKSS
VRIGQLMHYDYSSHKYVFSISNNFRSLLPDVSPIMNKRYNVCAVVGNSGILTGSQCGQEI
DKSDFVFRCNFAPTEAFHKDVGRKTNLTTFNPSILEKYYNNLLTIQDRNNFFLSLKKLDG
AILWIPAFFFHTSATVTRTLVDFFVEHRGQLKVQLAWPGNIMQHVNRYWKNKHLSPKRLS
TGILMYTLASAICEEIHLYGFWPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEF
QLLYRMHGEGLTKLTLSHCA
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgagaaattgcaaaatggcccgagtcgccagtgtgctagggctggtcatgctcagcgtg
gccctgctgattttatcgcttatcagctacgtgtctctgaaaaaggagaacatcttcacc
actcccaagtacgccagcccgggggcgccccgaatgtacatgttccacgcgggattccgg
tcacagtttgcactgaagtttctagaccagtcatttgtgcccattacgaattctctcacc
catgaactccaagagaaaccttctaaatggacatttaatcggacagcgtttttacatcaa
aggcaagaaattcttcagcatgtcgatgtaataaaaaatttttctttgaccaagagtagt
gttcggattggacaactaatgcattatgattattccagccataaatatgtcttctcgatt
agcaataacttccggtccctgctcccagatgtgtcgcccattatgaataagcgttataat
gtttgtgctgtggttggaaacagtggaatcttgacagggagtcagtgtggacaagaaata
gataaatcagattttgtttttcgatgcaattttgccccgacagaggctttccacaaagat
gttggaaggaaaaccaacctcacaaccttcaatccgagcatcttagagaaatattacaac
aatcttttaaccattcaggaccgtaacaacttcttcctcagtttaaaaaagcttgatggg
gccatactttggatccctgcatttttcttccacacttctgcaactgtaacgagaacgcta
gtggatttttttgttgagcacagaggtcagttaaaggtccagttggcttggcctggaaat
atcatgcaacatgtcaacaggtactggaaaaacaaacacctgtcacccaaacgactgagc
acaggtatcctaatgtatactcttgcatctgcaatatgtgaagagatccacttgtacggt
ttctggccctttggatttgaccccaacaccagggaggatctgccctaccactactatgac
aaaaaaggaaccaaatttaccaccaagtggcaggagtctcaccagctgcctgctgagttt
cagctgctctatcgaatgcatggggaagggctcacgaagctcactctgtcacactgtgcc
taa

DBGET integrated database retrieval system