KEGG   Mus musculus (mouse): 20452
Entry
20452             CDS       T01002                                 

Gene name
St8sia4, P, PST, PST-1, SIAT8-D, ST, ST8SiaIV, Sia, Siat8d
Definition
(RefSeq) ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
  KO
K06614  alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8D) [EC:2.4.99.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    20452 (St8sia4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     20452 (St8sia4)
Glycosyltransferases [BR:mmu01003]
 Terminal extension
  Sialyltransferase
   20452 (St8sia4)
SSDB
Motif
Pfam: Glyco_transf_29 DUF5037
Other DBs
NCBI-GeneID: 20452
NCBI-ProteinID: NP_033209
MGI: 106018
Ensembl: ENSMUSG00000040710
Vega: OTTMUSG00000048753
UniProt: Q64692 Q53WR7 Q6PAS1
Position
1; 1 D
AA seq 359 aa
MRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELCLSRSLVNSSDKIIRKAG
STIFQHSVQGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNI
SHNLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSGCGKEIDSHNFVIRCNLAPVVEFAAD
VGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWV
NALILKNKLQVRTAYPSLRLIHAVRGYWLTNKVPIKRPSTGLLMYTLATRFCDEIHLYGF
WPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGALKLTTGKCMKQ
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcgctcaattagaaaacggtggaccatctgcactataagtctactcctgatcttttat
aagacaaaagaaatagccagaactgaggagcaccaagagacgcaactcatcggagatggt
gaactgtgtttgagcagatcacttgtcaacagctctgataaaatcatccggaaggctggc
tccaccatcttccaacattctgtacaaggctggaaaatcaattcttctttagtcctggag
ataaggaagaacattcttcgtttcttagatgcggaacgtgacgtatctgtggtcaagagc
agttttaagcctggtgatgtcatacactatgtgctggacagacgccggacactaaatatt
tctcacaatctgcatagcctcctgcctgaagtttcaccaatgaaaaaccgcaggtttaag
acctgtgcagttgttggaaattccggcattctgctagacagtggatgtggaaaggagatt
gacagccacaactttgtaataaggtgcaatctagctcctgtggtggagttcgctgctgat
gtggggactaaatcagattttattaccatgaatccatcagttgtgcaaagagcatttgga
ggctttcggaatgagagtgacagagaaaaatttgtgcatagactctccatgctgaatgac
agcgtcctttggattcctgccttcatggtcaaaggaggagagaagcacgtggagtgggtt
aatgcattaatccttaagaacaaactgcaagtgcgaactgcctatccatcacttagactt
attcatgcagtcagaggatactggctgactaacaaagttcctatcaaaagacctagcaca
ggtctcctcatgtatacacttgccaccagattctgtgatgaaattcacctttatggattc
tggccatttcccaaggatctgaatggaaaagctgtcaaatatcattactatgatgactta
aaatatagatacttttccaacgccagtcctcacaggatgccattagaatttaaaacattg
aatgtgctacacaatagaggagctctaaaactgaccacaggaaagtgcatgaagcaataa

DBGET integrated database retrieval system