KEGG   Mus musculus (mouse): 20464
Entry
20464             CDS       T01002                                 

Gene name
Sim1, bHLHe1, bHLHe14, mSIM1
Definition
(RefSeq) single-minded family bHLH transcription factor 1
  KO
K09100  single-minded
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20464 (Sim1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    20464 (Sim1)
SSDB
Motif
Pfam: SIM_C PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 20464
NCBI-ProteinID: NP_035506
MGI: 98306
Ensembl: ENSMUSG00000019913
UniProt: Q61045
Position
10 B3; 10 24.87 cM
AA seq 765 aa
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGL
GEAWGHTSRTSPLDNVGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPADHDEMTAVLTAHQPYHSHFVQEYEIERSFFLRMKCVLAKRNAGLTCGGY
KVIHCSGYLKIRQYSLDMSPFDGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQDLIEKTLYHHVHGCDTFHLRCAHHLLLVKGQVTTKYYRFLAK
QGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQISASKPTFSYTSSS
TPTISDNRKGAKSRLSSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLL
DPERPGSQHELSCAYRQFPDRSSLCYGFALDHSRLVEDRHFHTQACEGGRCEAGRYFLGA
PPTGRDPWWGSRAALPLTKASPESREAYENSMPHITSIHRIHGRGHWDEDSVVSSPDPGS
ASESGDRYRTEQYQNSPHEPSKIETLIRATQQMIKEEENRLQLRKAPPDQLASINGAGKK
HSLCFANYQQPPPTGEVCHSSALASTSPCDHIQQREGKMLSPHENDYDNSPTALSRISSP
SSDRITKSSLILAKDYLHSDMSPHQTAGDHPAISPNCFGSHRQYFDKHAYTLTGYALEHL
YDSETIRNYSLGCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgaaagaaaagtctaaaaatgctgcccgaacgaggagggagaaagaaaacagtgaattt
tatgaactggctaaattactgcctttaccctcagccatcacctcccaactggacaaagca
tccatcatcagactcacgaccagctatctcaaaatgagagtggtctttccagaagggctt
ggcgaggcgtggggccacaccagtcgaaccagccccttggacaacgttggtcgcgaactc
ggctctcatctactccagactctggatggcttcatcttcgtggtggccccagatgggaag
atcatgtacatttcagagacagcttcagttcacctgggcctttctcaggtagagctgact
gggaacagcatctatgaatatatccacccggctgaccacgatgagatgacagccgtgctc
acagcccatcagccctaccactctcactttgtacaggagtacgagatcgaacgctccttc
tttctaaggatgaagtgtgttttggccaagcggaatgctggcctcacctgcggtggctac
aaggtcattcactgtagtggctacctgaagatccgccagtacagcctggatatgtctccc
tttgatggatgctaccaaaatgtgggcttggtggctgtgggtcactccctgcctccgagt
gctgtgacagagatcaaactacacagcaacatgttcatgttccgagccagtctggatatg
aagcttattttcctggactccagggtggcagagctgactggatatgaacctcaggacttg
attgagaagaccctgtaccatcacgtgcatggctgtgacaccttccacctacgctgtgca
caccacttactgttggtgaagggacaagtgaccaccaagtactacaggttcttggcgaag
cagggcggctgggtctgggtgcagagttacgccaccatcgtacacaacagccgctcctcc
aggccgcactgcatcgtcagcgtcaactacgtcctcacagacacagaatacaaagggcta
cagctctccctggaccagatatcagcctctaagcccactttctcctataccagcagttcc
actcccactatctcggacaacaggaagggggccaagtcaaggctctccagtagcaagtca
aaatctaggacctccccatatccccagtattcgggattccatactgagagatcggaatct
gaccatgacagccagtggggtggaagtcccctgactgatactgcctccccacagctcctg
gacccagagaggcctggctctcagcacgaattgtcctgtgcgtataggcagttcccagat
cgcagttctctctgctatggttttgctctggaccattccaggctggtggaggacaggcac
ttccacacccaagcctgcgagggaggacggtgcgaggcaggcaggtacttcctgggagca
ccacctactgggagagatccctggtggggctctcgagcagctttgcctcttaccaaggcc
tccccggagagcagagaagcctatgagaacagcatgcctcatatcacctccatccacaga
atccacggtcgaggtcactgggatgaagatagtgtggtcagctctccagaccctgggtca
gccagtgaatctggtgaccgataccgcaccgaacagtatcaaaatagcccacatgaacct
agcaaaattgaaactctcataagagccacccagcagatgattaaagaggaagagaacaga
ttacagctaaggaaagcccctccagaccaactggcttccattaatggagctgggaaaaaa
cactccctctgttttgcaaactatcaacagcccccacccacaggtgaggtctgccacagc
tctgctcttgccagcacttcaccatgtgaccatatccagcagagagagggaaagatgctc
agccctcatgaaaatgactatgacaacagccccactgcactgtctcggataagtagtcct
agttctgatcgcattacaaagtctagtttaatcctggctaaagactatctacattcagat
atgtctccccatcagacagcaggagaccatcctgccatctctccaaactgttttggctcc
caccggcagtattttgataagcatgcctatacattgactggttatgccctggaacactta
tatgacagtgagactattagaaactattccttgggctgcaatggctcacactttgatgtg
acttcccatctaaggatgcaaccagacccagcacaaggacacaagggaacatctgttata
ataaccaatggaagttga

DBGET integrated database retrieval system