KEGG   Mus musculus (mouse): 20467
Entry
20467             CDS       T01002                                 

Symbol
Sin3b, 2810430C10Rik
Name
(RefSeq) transcriptional regulator, SIN3B (yeast)
  KO
K23213  paired amphipathic helix protein Sin3b
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    20467 (Sin3b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Other HDAC associated proteins
     20467 (Sin3b)
SSDB
Motif
Pfam: Sin3a_C Sin3_corepress PAH DUF5077
Other DBs
NCBI-GeneID: 20467
NCBI-ProteinID: NP_033214
MGI: 107158
Ensembl: ENSMUSG00000031622
Vega: OTTMUSG00000062065
UniProt: Q62141 Q3TN09
Structure
PDB: 

Position
8 B3.3; 8 35.08 cM
AA seq 1098 aa
MAHAGSGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLE
IMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSSQ
DNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLE
ILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGS
CEMNSGQKNEEKSLEHNKKRSRPSLLRPVSAPAKKKMKLRGTKDLSIAAVGKYGTLQEFS
FFDKVRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFLGVK
ELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQPKCSGRTAICKEVLNDTWV
SFPSWSEDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPE
DQEKLRLDDCLGGTSEVIQRRAIHRIYGDKAPEVIESLKRNPATAVPVVLKRLKAKEEEW
REAQQGFNKIWREQYEKAYLKSLDHQAVNFKQNDTKALRSKSLLNEIESVYDEHQEQHSE
GRSAPSSEPHLIFVYEDRQILEDAAALISYYVKRQPAIQKEDQGTIRQLLHRFLPSLFFS
QQCPGTSDDSADERDRDRDSAEPERRRPTDEKPPADASPEPPKVLDDVYSLFFANNNWYF
FLRLHQTLCARLLKIYRQAQKQLLEHRREQEREQLLCEGRREKAADPAMELRLKQPSEVE
LEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYIGFTMDKLVQNIARQLHHLVSD
DVCLKVVELYLNEQQRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFKVMFLQRRGQ
VIMTIELLDTEEAQTEDPVEVQHLARYVEQYVGSEGASSSSTEGFLLKPVFLQRNLKKFR
RWQCEQVRAMRGEAKSSWKRLMGVESACDVDCRFRLGTHKMVFIVNSEDYMYRRGTLCRA
KQVQPLVLLRHHRHFEEWHGRWLEDNVTVAAAGLVQDWLMGEEEEDMVPCKTLCETAHVH
GLPVTRYRVQYSRRPASP
NT seq 3297 nt   +upstreamnt  +downstreamnt
atggcgcatgcaggcagcggaggctccgcgggccggggattcggtggctcccgctggggt
cgttcgggctccggagggcacgagaagctgccggtgcacgtggaggacgctctcacctac
ctcgaccaggtgaagatccgctttggcagtgaccctgccacctacaacggcttcctggag
atcatgaaggagttcaaaagccagagcatcgacactcctggtgtgatcaggcgtgtgtcc
cagctcttccatgagcaccctgacctcatcgtggggtttaatgctttccttccgcttgga
taccgtatagacattcccaagaacggcaagctgaacatccagtcgccgctgagcagccag
gacaactcccatagccatggtgactgtggggaggacttcaagcagatgtcctacaaggag
gacagaggccaggtgcccctggagtctgactctgtggagttcaacaatgctatcagctat
gtgaacaagatcaagacccgctttctggaccaccctgagatctacaggtccttcctggag
atcctacacacctaccagaaggaacagctgcacactaagggccgtccattccgtggcatg
tctgaggaggaggttttcacagaggtggccaatcttttccgtggtcaggaggacctgctg
tcagagttcggacagttcctgcctgaggcaaagcggtccctgtttacaggcaatgggtcg
tgcgagatgaacagtgggcagaagaatgaggagaagagtctggaacacaacaagaaacgc
tctcggccttcactcctgcgccctgtgtctgcgccagccaagaagaagatgaagctccga
ggcaccaaagacctgtccattgctgccgtggggaaatacggcacactgcaggaattctcc
ttctttgacaaggtgcgcagggtgctgaagagccaggaggtatatgagaactttctgcgc
tgcattgcgctcttcaatcaggagctggtgtccgggtctgagttgctgcagcttgtcagt
ccattcctggggaaatttccagaactctttgcacagttcaagtccttcctaggagtgaaa
gagctgtcctttgcaccacctatgagtgaccggtctggagatgggataagcagagaaatt
gactatgcgtcttgtaagcgaataggatccagctatcgggcacttcccaagacctaccag
cagcccaagtgcagcggaaggactgccatttgcaaggaggtcctgaatgatacatgggtc
tcctttccatcctggtctgaagactccacctttgttagctccaagaagacgccctacgag
gagcaactgcatcgctgtgaggatgagagatttgaattggatgttgtcctggagaccaac
ctggccaccatccgagtgctggagagtgtgcagaagaagttgtcacggatggctcctgag
gaccaggagaagctccgcctggatgactgcctgggtggcacatcagaggtgattcaacgc
cgtgccatacaccgcatctatggagacaaggccccagaggtcattgagagcctgaaaagg
aaccctgccaccgctgtgcctgtcgttctgaaaaggctgaaggccaaggaggaggagtgg
cgggaggcccagcagggcttcaacaagatctggcgtgagcagtacgagaaagcatacctc
aagtccctggaccaccaggctgtgaacttcaagcagaatgacaccaaggcactgcgctct
aagagcctgctcaatgagatcgaaagtgtctatgatgagcaccaggagcagcactcagag
ggccgcagtgcgccttccagcgagccgcaccttatcttcgtgtatgaggaccgacagatc
ctagaggacgcagcagcactcatcagctactatgttaagcggcagccagccattcagaaa
gaggaccagggcactatccgccagctgcttcaccgtttcctgcccagcctgttcttctcg
cagcagtgccccggcacctccgatgactctgctgatgagcgcgaccgggaccgggacagc
gctgagcctgagcgccgccggcccacagatgagaagccccctgcagatgcatctccagaa
ccgcccaaggtcctggacgatgtgtacagtctgttttttgccaacaacaactggtacttc
ttcctgcggctgcaccagacgctgtgcgcccgcctgctcaagatctaccggcaggcgcag
aagcagctgctggaacatcgacgagagcaggagagggagcagctgctgtgcgagggccgc
cgtgagaaggctgcagaccctgccatggagctgcgactcaagcagcctagtgaagtggag
ctggaggagtactacccggccttcctggacatggtgcggagcctgctagaggggagcatc
gaccccacacagtatgaggacactctccgtgagatgttcaccatccatgcctacattggc
ttcactatggacaagctagtgcagaacattgcccgccagctacaccatctggtgagtgac
gacgtatgtctgaaggtggtagagctgtacctgaatgagcagcagcgaggggcagcgggg
ggaaacctgtcctccagatgtgttcgtgcagcacgggagactagctatcagtggaaggcg
gagcgctgcatggcagatgagaactgcttcaaggtaatgttcctgcagcgcagaggtcag
gtgatcatgaccatagagctcctggacacagaagaggcacagactgaggaccctgtggag
gtacagcacctggctcgctatgtggagcagtatgtggggtctgagggtgcatccagctca
tctactgaaggcttcctgctgaagccggtgttcctgcagaggaacctgaagaagttccgg
cgttggcagtgtgagcaggtacgtgccatgcgcggtgaggctaagagctcctggaagcgg
ctcatgggcgtggagagcgcttgtgatgtggactgccggttccgcttgggcacacacaag
atggtgttcatcgtcaattccgaggactacatgtaccgccgtgggacactatgccgtgcc
aagcaggtgcagcccctggtgttgttgcgccaccaccggcacttcgaggagtggcatggt
cgctggctggaggacaatgtaactgtggcggcggcagggctggtgcaggactggctgatg
ggtgaggaagaggaggacatggtaccctgcaagacgctttgcgagactgcgcatgttcac
gggctgccggtgactcgctaccgagtgcagtacagccgccgccctgcttcaccctga

DBGET integrated database retrieval system