KEGG   Mus musculus (mouse): 20469Help
Entry
20469             CDS       T01002                                 

Gene name
Sipa1, Spa1
Definition
(RefSeq) signal-induced proliferation associated gene 1
  KO
K08013  signal-induced proliferation-associated gene 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    20469 (Sipa1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    20469 (Sipa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rap_GAP PDZ PDZ_6 CREPT ZapB Lzipper-MIP1 bZIP_2 PI3K_P85_iSH2 TMF_TATA_bd
Motif
Other DBs
NCBI-GeneID: 20469
NCBI-ProteinID: NP_001157952
MGI: 107576
Ensembl: ENSMUSG00000056917
UniProt: E9Q0Y4 Q3UE96
Position
19 A; 19 4.34 cM
AA seq 1038 aa AA seqDB search
MWAGGVGSPRRGMAPAPTDDLFARKLRQPARPPLTPHTFEPRPARGPLLRSGSDAGEVRP
PTPASPRARAHSHEDASRPAATPTRLFTDPLALLGLPAEEPEPTFPPVLEPRWFAHYDVQ
SLLFDWAPRPRGTGSHIEANSGTLAEGQTTTSDLLLGAPGFVSELGGEGELGLGGPISPP
VPPALPNAAVSVLEEPQTRTTAYSLEHADLGAGYYRKYFYGKEHQNFFGLDEALGPVAVS
LRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVAPRLS
PTCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGAAFMQFL
TLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQQLLR
KRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHAPCTPHTSYRVAVSRTQDTP
AFGPALPEGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLATNEV
TTTSLDSASRFGLPSLGGRRRATPRSPGAELQAAGALMWGVRAAPGARVAAGAETSGPED
AEVPCLLGISAETLVLVAPRDGRVVFNCACRDVLAWTFSEHQLDLYHGRGEAITLRLDGA
PGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFITHVERFTFAETTGLRP
GARLLRVCGQTLPKLGPEAAAQMLRSAPKVCVTVLPPDESGRPRRSFSELYMLSLKEPSR
RGGPEPVQDETGKLVILPPTKQLLHFCLKDSSSPPGPGDLTEERTEFLRSHNSLSSGSSL
SDEAPVLPNTTPDLLLVTTANPSAPGTDRETPPSQDQSGSPSSHEDTSDSGPELRASILP
RTLSLRNSISKIMSEAGSETLEDEWQSISEIASTCNTILESLSREGQPISESGDPKEALK
CDSEPEPGSLSEKVSHLESMLWKLQEDLQREKADRAALEEEVRSLRHNNQRLLAESESAA
TRLLLASKHLGAPTTDLA
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccggcggtgtggggagccctcggcggggcatggcccctgcacctaccgatgac
ctctttgcccgtaagcttcgccaacctgcccggcccccactgacaccacatacctttgag
ccgaggccagctcggggcccactcttgcgcagtggcagtgatgctggtgaagtccggccc
cctacaccagccagcccccgtgcccgtgcccacagccacgaggatgccagccgccctgct
gcaacccctactcggctcttcactgacccactggcactgctagggttgccagcagaagag
ccagagcccaccttcccgccagtgctggaaccccggtggtttgctcactatgatgtgcag
agcttgctctttgactgggctccacgacctcgggggacaggcagccatatagaggcaaac
tctgggaccttagctgagggccagactaccacctcagatctactgctcggggcacctggc
tttgtgagcgagcttggtggtgagggtgagctagggctgggtgggccaatatccccacct
gtgccccctgcactgcctaatgcggctgtgtccgtcctggaggagccacagacccggacc
acagcttacagcctggagcacgcagatctgggtgcaggctactaccgcaagtacttctat
ggcaaagaacaccagaacttctttgggctggatgaggcgctgggtccggtggccgtgagc
ctgcgacgggaggagaaagagggcagcggagggggcaccctacacagctaccgggtcatc
gtgcggaccacgcagctccggaccctccgtggcaccatctcggaggacgcactgcctccc
ggccccccgaggggcctatctccgaggaagcttctggaacatgtggctccacggctgagc
cccacctgcctgcgcctgggttcagcctctcccaaggtgccccgcacgctgcttactctg
gatgagcaagtgctgagcttccaacgcaaggtgggcatcctgtactgccgcgcaggccag
ggctctgaggaagagatgtacaacaaccaggaggccggagcagcctttatgcagttcctt
accttgctgggtgatgtggtgcgactcaaaggctttgaaagttaccgggcccagctggat
accaaaacggattccacgggcacacactcactctacaccacctaccaagaccatgagatc
atgtttcacgtgtccacgatgctgccttacacgcctaataaccagcaacagctcctgagg
aagcgtcatatcggcaacgatattgtgaccatcgtgttccaggagcccggtagcaagccc
ttctgccctacgacaatccgctctcacttccagcacgttttcttggtggtgcgtgcgcat
gctccctgcaccccacacacctcatacagggtggcagtgagccgcacccaggacactcct
gccttcggtcctgcgctgccagaaggcggaggcccctttgcagccaatgccgatttccgg
gcctttctgttggctaaggcactcaatggtgagcaagcggctggtcatgcacgccagttc
cacgccatggctacacgcacacgccaacagtacctgcaggacctggctactaatgaagtg
accactacttcgctggactcggcttcgcggtttggcctgccatctctggggggtaggcgc
cgggcaacccctcggagcccaggcgcggagctacaggcggcgggtgcgctgatgtggggc
gtacgcgcggctccaggggcgcgggtcgcagcgggagctgaaacgagcggtccggaggac
gccgaggtgccctgcttgttgggcatctcagcagagacactggtgctggtggcacctcgc
gacggccgcgtggtcttcaattgtgcctgtcgcgacgtattggcctggaccttctcagag
caccaactcgatctgtaccacgggcgcggggaggcgatcacgctgcggctcgacggggcc
ccagggcaagccgtgggcgaagtcgtggcacgtctgcagctggtgagccgcgggtgtgag
accagagaactagcgctgcccagagatggccaaggtcgcctgggcttcgaggtggatgca
gaaggcttcatcacgcacgtggagcgcttcacgtttgcggagaccacggggcttcggcct
ggagctcgtttgctgcgagtctgcggccagacgctgcccaagctgggtcccgaagctgct
gcccagatgctgcgctctgcgcccaaggtctgcgtcacggtcctacccccagacgagagc
ggccggccgcgaaggagcttttcggagctctatatgctctctctgaaggaacccagccgg
cgggggggtccagagccagtacaggatgaaactgggaagttggtcatattgcctcccacc
aagcagctgctacatttttgcctgaaagacagcagcagtcctccggggcctggggatctg
actgaggagaggacagagttcctgcgcagccacaactccctgtcatctggaagctccctg
tccgatgaggctccagtcctgcccaacaccactccagacctcctccttgtcaccactgcc
aacccatctgcacctggtactgacagagaaacacccccttcccaggaccagtcaggaagc
cccagtagccatgaagacaccagtgactcaggcccagaactgagggcctccatcctgccc
agaaccttgtctctgcggaattccatcagtaagattatgtcggaagctggcagtgagacc
ctggaggatgagtggcagtccatctcagagatcgcctccacttgcaacacaattctggag
tcactgtcccgggagggacaacccatctcagagagcggagaccccaaggaagctttaaag
tgtgattctgagccagaacccgggagcctgtcagaaaaggtctctcacctagagtccatg
ctctggaagctccaggaggacctgcagagggagaaggcggacagggcagccttggaggag
gaggttcggagcctcagacacaacaaccagaggctgctggcagagtccgagagtgccgcc
acccgcctgctcctggcctctaagcatctgggtgcacccactactgacctggcctga

DBGET integrated database retrieval system