KEGG   Mus musculus (mouse): 20469
Entry
20469             CDS       T01002                                 

Gene name
Sipa1, SP, Spa1
Definition
(RefSeq) signal-induced proliferation associated gene 1
  KO
K08013  signal-induced proliferation-associated gene 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    20469 (Sipa1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    20469 (Sipa1)
SSDB
Motif
Pfam: Rap_GAP PDZ PDZ_6 ZapB bZIP_2 Lzipper-MIP1
Other DBs
NCBI-GeneID: 20469
NCBI-ProteinID: NP_001157952
MGI: 107576
Ensembl: ENSMUSG00000056917
UniProt: E9Q0Y4 Q3UE96
Position
19 A; 19 4.34 cM
AA seq 1038 aa
MWAGGVGSPRRGMAPAPTDDLFARKLRQPARPPLTPHTFEPRPARGPLLRSGSDAGEVRP
PTPASPRARAHSHEDASRPAATPTRLFTDPLALLGLPAEEPEPTFPPVLEPRWFAHYDVQ
SLLFDWAPRPRGTGSHIEANSGTLAEGQTTTSDLLLGAPGFVSELGGEGELGLGGPISPP
VPPALPNAAVSVLEEPQTRTTAYSLEHADLGAGYYRKYFYGKEHQNFFGLDEALGPVAVS
LRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVAPRLS
PTCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGAAFMQFL
TLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQQLLR
KRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHAPCTPHTSYRVAVSRTQDTP
AFGPALPEGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLATNEV
TTTSLDSASRFGLPSLGGRRRATPRSPGAELQAAGALMWGVRAAPGARVAAGAETSGPED
AEVPCLLGISAETLVLVAPRDGRVVFNCACRDVLAWTFSEHQLDLYHGRGEAITLRLDGA
PGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFITHVERFTFAETTGLRP
GARLLRVCGQTLPKLGPEAAAQMLRSAPKVCVTVLPPDESGRPRRSFSELYMLSLKEPSR
RGGPEPVQDETGKLVILPPTKQLLHFCLKDSSSPPGPGDLTEERTEFLRSHNSLSSGSSL
SDEAPVLPNTTPDLLLVTTANPSAPGTDRETPPSQDQSGSPSSHEDTSDSGPELRASILP
RTLSLRNSISKIMSEAGSETLEDEWQSISEIASTCNTILESLSREGQPISESGDPKEALK
CDSEPEPGSLSEKVSHLESMLWKLQEDLQREKADRAALEEEVRSLRHNNQRLLAESESAA
TRLLLASKHLGAPTTDLA
NT seq 3117 nt   +upstreamnt  +downstreamnt
atgtgggccggcggtgtggggagccctcggcggggcatggcccctgcacctaccgatgac
ctctttgcccgtaagcttcgccaacctgcccggcccccactgacaccacatacctttgag
ccgaggccagctcggggcccactcttgcgcagtggcagtgatgctggtgaagtccggccc
cctacaccagccagcccccgtgcccgtgcccacagccacgaggatgccagccgccctgct
gcaacccctactcggctcttcactgacccactggcactgctagggttgccagcagaagag
ccagagcccaccttcccgccagtgctggaaccccggtggtttgctcactatgatgtgcag
agcttgctctttgactgggctccacgacctcgggggacaggcagccatatagaggcaaac
tctgggaccttagctgagggccagactaccacctcagatctactgctcggggcacctggc
tttgtgagcgagcttggtggtgagggtgagctagggctgggtgggccaatatccccacct
gtgccccctgcactgcctaatgcggctgtgtccgtcctggaggagccacagacccggacc
acagcttacagcctggagcacgcagatctgggtgcaggctactaccgcaagtacttctat
ggcaaagaacaccagaacttctttgggctggatgaggcgctgggtccggtggccgtgagc
ctgcgacgggaggagaaagagggcagcggagggggcaccctacacagctaccgggtcatc
gtgcggaccacgcagctccggaccctccgtggcaccatctcggaggacgcactgcctccc
ggccccccgaggggcctatctccgaggaagcttctggaacatgtggctccacggctgagc
cccacctgcctgcgcctgggttcagcctctcccaaggtgccccgcacgctgcttactctg
gatgagcaagtgctgagcttccaacgcaaggtgggcatcctgtactgccgcgcaggccag
ggctctgaggaagagatgtacaacaaccaggaggccggagcagcctttatgcagttcctt
accttgctgggtgatgtggtgcgactcaaaggctttgaaagttaccgggcccagctggat
accaaaacggattccacgggcacacactcactctacaccacctaccaagaccatgagatc
atgtttcacgtgtccacgatgctgccttacacgcctaataaccagcaacagctcctgagg
aagcgtcatatcggcaacgatattgtgaccatcgtgttccaggagcccggtagcaagccc
ttctgccctacgacaatccgctctcacttccagcacgttttcttggtggtgcgtgcgcat
gctccctgcaccccacacacctcatacagggtggcagtgagccgcacccaggacactcct
gccttcggtcctgcgctgccagaaggcggaggcccctttgcagccaatgccgatttccgg
gcctttctgttggctaaggcactcaatggtgagcaagcggctggtcatgcacgccagttc
cacgccatggctacacgcacacgccaacagtacctgcaggacctggctactaatgaagtg
accactacttcgctggactcggcttcgcggtttggcctgccatctctggggggtaggcgc
cgggcaacccctcggagcccaggcgcggagctacaggcggcgggtgcgctgatgtggggc
gtacgcgcggctccaggggcgcgggtcgcagcgggagctgaaacgagcggtccggaggac
gccgaggtgccctgcttgttgggcatctcagcagagacactggtgctggtggcacctcgc
gacggccgcgtggtcttcaattgtgcctgtcgcgacgtattggcctggaccttctcagag
caccaactcgatctgtaccacgggcgcggggaggcgatcacgctgcggctcgacggggcc
ccagggcaagccgtgggcgaagtcgtggcacgtctgcagctggtgagccgcgggtgtgag
accagagaactagcgctgcccagagatggccaaggtcgcctgggcttcgaggtggatgca
gaaggcttcatcacgcacgtggagcgcttcacgtttgcggagaccacggggcttcggcct
ggagctcgtttgctgcgagtctgcggccagacgctgcccaagctgggtcccgaagctgct
gcccagatgctgcgctctgcgcccaaggtctgcgtcacggtcctacccccagacgagagc
ggccggccgcgaaggagcttttcggagctctatatgctctctctgaaggaacccagccgg
cgggggggtccagagccagtacaggatgaaactgggaagttggtcatattgcctcccacc
aagcagctgctacatttttgcctgaaagacagcagcagtcctccggggcctggggatctg
actgaggagaggacagagttcctgcgcagccacaactccctgtcatctggaagctccctg
tccgatgaggctccagtcctgcccaacaccactccagacctcctccttgtcaccactgcc
aacccatctgcacctggtactgacagagaaacacccccttcccaggaccagtcaggaagc
cccagtagccatgaagacaccagtgactcaggcccagaactgagggcctccatcctgccc
agaaccttgtctctgcggaattccatcagtaagattatgtcggaagctggcagtgagacc
ctggaggatgagtggcagtccatctcagagatcgcctccacttgcaacacaattctggag
tcactgtcccgggagggacaacccatctcagagagcggagaccccaaggaagctttaaag
tgtgattctgagccagaacccgggagcctgtcagaaaaggtctctcacctagagtccatg
ctctggaagctccaggaggacctgcagagggagaaggcggacagggcagccttggaggag
gaggttcggagcctcagacacaacaaccagaggctgctggcagagtccgagagtgccgcc
acccgcctgctcctggcctctaagcatctgggtgcacccactactgacctggcctga

DBGET integrated database retrieval system