KEGG   Mus musculus (house mouse): 20472
Entry
20472             CDS       T01002                                 
Symbol
Six2
Name
(RefSeq) sine oculis-related homeobox 2
  KO
K19472  homeobox protein SIX2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20472 (Six2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain SINE
    20472 (Six2)
SSDB
Motif
Pfam: SIX1_SD Homeodomain Homeobox_KN HTH_3 Phage_mat-A YdaS_antitoxin
Other DBs
NCBI-GeneID: 20472
NCBI-ProteinID: NP_035510
MGI: 102778
Ensembl: ENSMUSG00000024134
UniProt: Q62232
Position
17:complement(85970276..85995682)
AA seq 296 aa
MSMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHR
GNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRS
IWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR
AAEAKERENSENSNSSSHNPLASSLNGSGKSVLGSSEDEKTPSGTPDHSSSSPALLLSPP
PPPGLPSLHSLGHPPGPSAVPVPVPGGGGADPLQHHHSLQDSILNPMSANLVDLGS
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtccatgctgcccaccttcggcttcacgcaggagcaagtggcgtgcgtgtgcgaggtg
ctgcagcagggcggcaacatcgagcggctgggtcgcttcctgtggtcgctgcccgcctgc
gagcacctccacaagaatgaaagcgtgctcaaggccaaggccgtggtggccttccaccgg
ggcaacttccgcgagctctacaaaatcctggagagccaccagttctcgccgcacaaccac
gccaagctgcagcagttgtggctcaaggcgcactacatcgaggcggagaagctgcgcggc
cggccgctgggcgccgtgggcaagtaccgcgtgcggcgcaagttcccgctgccccgctcc
atctgggacggcgaggagaccagctactgcttcaaggagaagagccgcagcgtgctgcgc
gagtggtacgctcacaacccctacccgtcgccacgagagaagcgcgagctggccgaggcc
accggcctcaccaccacgcaagtcagcaactggttcaagaaccggcggcagcgcgacagg
gcggccgaggccaaggaaagggagaacagcgagaactccaattccagcagccacaacccg
ctggcttcctcgctcaatggcagtggcaagtcggtgctaggcagttccgaggatgagaag
acgccgtcggggactccagaccactcgtcgtccagtcccgctctgttgctcagcccgccg
ccgccccctgggctgccttccctgcacagcctgggccaccctccgggcccgagcgcagta
cccgtaccagtgcccggtggaggcggcgcggacccactgcagcatcaccacagcctgcag
gactccatactcaaccccatgtcggccaaccttgtggacctgggctcctag

DBGET integrated database retrieval system