KEGG   Mus musculus (house mouse): 20473
Entry
20473             CDS       T01002                                 
Symbol
Six3, E130112M24Rik, Six3a, Six3alpha, Six3b, Six3beta
Name
(RefSeq) sine oculis-related homeobox 3
  KO
K19473  homeobox protein SIX3/6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20473 (Six3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain SINE
    20473 (Six3)
SSDB
Motif
Pfam: SIX1_SD Homeodomain Homeobox_KN HTH_3
Other DBs
NCBI-GeneID: 20473
NCBI-ProteinID: NP_035511
MGI: 102764
Ensembl: ENSMUSG00000038805
UniProt: Q62233
Position
17:85921036..85933619
AA seq 333 aa
MVFRSPLDLYSSHFLLPNFADSHHCSLLLASSGGGSGASGGGGGAGGGGGGNRAGGGGAG
GAGGGSGGGGSRAPPEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAP
GACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEK
LRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKREL
AQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPST
AASPTTSVSSLTERADTGTSILSVTSSDSECDV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggtattccgctcccccctagatctctattcctcccacttcttgttgccaaacttcgcc
gattctcaccactgctccctacttctggcgagtagcggcggcgggagcggtgcgagcggc
ggcggcggcggcgcgggaggaggcggcggcgggaaccgtgcgggaggcggcggtgctggc
ggagcaggcggcggcagcggcggcggcggctccagggcccccccggaagagttgtccatg
ttccagttgcccaccctcaacttctcgccggagcaggtggccagcgtctgcgagacgctg
gaggagacgggcgacatcgagcggctgggccgcttcctctggtcgctgcccgtggccccc
ggggcgtgcgaggccatcaacaaacacgagtcgatcctgcgcgcgcgcgctgtcgtcgcc
ttccacaccggcaacttccgcgacctgtaccacatcctggagaaccacaagttcactaag
gagtctcacggcaagctgcaagccatgtggctcgaggcgcactaccaggaggccgagaag
ctgcgcggccgcccgctcggcccggtggacaagtaccgcgtgcgcaagaagttccctctg
ccgcgcaccatctgggatggcgagcagaagacccattgcttcaaggagcggactcggagc
ctgctgcgggagtggtacctgcaggatccctaccccaaccccagcaagaaacgcgaactg
gcgcaggccaccggcctcacccccacacaagtaggcaactggtttaagaaccggcgacag
cgcgaccgcgcagcggcggccaagaacaggctccagcatcaggccatcgggccgagcggg
atgcgctcgctggccgagcccggctgccccacgcacggctcagcagagtcaccgtccacg
gcggccagcccgaccaccagtgtgtccagcctgacggagcgcgcggacaccggcacttcg
atcctctcggtaacctccagcgactcggaatgtgatgtatga

DBGET integrated database retrieval system