KEGG   Mus musculus (house mouse): 20474
Entry
20474             CDS       T01002                                 
Symbol
Six4, AREC3, TrexBF
Name
(RefSeq) sine oculis-related homeobox 4
  KO
K15615  homeobox protein SIX4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    20474 (Six4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20474 (Six4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain SINE
    20474 (Six4)
SSDB
Motif
Pfam: SIX1_SD Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 20474
NCBI-ProteinID: NP_035512
MGI: 106034
Ensembl: ENSMUSG00000034460
UniProt: Q61321
Position
12:complement(73146383..73160805)
AA seq 775 aa
MSSSSPTGQIASAADIKQENGMESASEGQEAHREVAGGAAAGLSPPAPAPFPLEPGDAAA
ASRVSREEGAAAAGAADQVQLHSELLGRHQHAAAAQPPLAFSPDHVACVCEALQQGGNLD
RLARFLWSLPQSDLLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWY
KARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRY
PSPAEKRHLAKITGLSLTQVSNWFKNRRQRDRNPSETQSKSESDGNPSTEDESSKGHEDL
SPHPLSGASDGVTNLSLSSHVEPVYMQQIGNAKISLSSSGVLLNGSLVPASTSPVFLNGN
SFIQGHNGVILNGLNVGNTQTVSLNPPKMSSNIVGNGIAMTDILGSTSQDVKEFKVLQSS
AVNSAATTSYSPSAPVSFPGLIPCTEVKREGIQTVASQDGGSVVTFTTPVQINQYGIVQI
PNSGANGQFLNGSIGFSPLQLPPVSVAASQGNLSVTPSTSDGSTFTSEPATVQHGKLFLS
PLTPSAVVYTVPNSGQTVGAVKQEGLERGLVFSQLMPVNHSAQVNASLSSENLSGSGLHP
LTSSLVNVSAAHGFSLTPPTLLNPTELNPDLAESQPVSAPVASKCTVSSVSNTNYATLQN
CSLIPGQDLLSGPMTQAALGEIVPTAEEQVSHASTAVHQDFVREQRLVLQSVPNIKENFL
QNSENKATNNLMMLDSKSKYVLDGMVEAGCEDLGTDKKELAKLQTVQLDEDMQDL
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgtcctcttcctcccccaccgggcagattgcaagtgcggcggacatcaagcaggagaat
gggatggaaagcgcctcggaaggacaggaggcgcaccgagaagtggcggggggcgcggcg
gctgggctgagccccccggctccagctcctttccccctggagccgggggacgccgcggct
gcctccagggtaagccgggaggaaggggcagcggcggcgggagcggcagatcaggtacaa
ctccactcggaacttctgggcaggcaccagcacgcagccgccgcgcagcccccactggcc
ttctcgccggaccatgtcgcctgcgtgtgcgaggcgttgcagcaggggggcaacctggac
cgcctggcccggtttctttggtccctgccccagagcgatctgctacgtggcaacgagagc
cttctgaaggcgcgagcgctcgtggccttccaccagggcatctaccctgagttgtacagc
atcctcgagagccacagcttcgagtcggccaaccatccgctgctgcagcagctctggtac
aaggcgcgctacaccgaggccgagcgagcgcgcggccggccgctgggcgccgtggacaag
taccggctgcgcaggaaattccccttgccccgcaccatctgggacggcgaggagacggtg
tattgtttcaaggagaagtcgcgcaacgcgctcaaggagctctacaagcagaatcgctac
ccctcgccggctgagaagcggcacctggccaagatcaccggcctctccctcacccaggtc
agcaactggttcaagaaccggcggcagcgtgaccgaaacccctccgagacccagtccaaa
agcgaatcggatggcaaccccagtaccgaggatgaatccagcaagggacatgaggatttg
tctcctcatccactttcaggcgcatctgatggcgtcaccaacctcagcctctctagccac
gtggagccagtatatatgcaacaaattggaaatgctaagatatcactaagctcgtctgga
gttttgttgaatggaagcttagtacctgcaagtacttcacctgtcttccttaatggcaat
tcttttattcagggacacaatggagttatccttaatggactgaatgtgggaaatacacag
acagtgtcactgaacccacccaaaatgtcttcaaacattgtgggcaatggcatagccatg
acagacatcctgggatctacctcccaggatgtgaaagaattcaaagtcctccagagttct
gctgtgaactcagcagccaccacctcctacagccctagtgcccctgtgtcattcccaggg
ctgataccctgcactgaagtgaaaagagaaggcattcagacagtggcctcccaggacggt
ggctctgtggtgacttttactacacccgtgcaaattaaccagtatggcattgtccagatc
cctaattctggagccaacggccagttccttaatgggagcattggattctctccactgcag
ctgcctcctgtctcagtagcagcttcacaaggtaatctttcagttaccccaagcacttcg
gacggaagcacatttacaagtgagccagccacagtccagcacggtaaacttttcctgagc
cctcttacccccagtgcagtggtatacaccgttcctaattcaggccagactgtaggagct
gtgaaacaggaaggcttagaaagaggcctggtcttttctcagttgatgcctgtcaatcac
agtgcacaagtaaatgcaagcctgtcttcggaaaatctctctgggagtggcctccatcct
ctgacctcgtcgttggttaatgtgtccgccgcccacggtttttccctgaccccccctaca
ctacttaatcccactgagctcaaccctgaccttgccgagagccagcccgtgtctgcacct
gtggcaagcaaatgtactgtgtcatctgtcagcaacactaactatgcaacccttcagaac
tgttcccttattccggggcaagacctattgtccggcccgatgacccaggctgccctgggt
gagatcgtacccacagctgaagagcaggtgagccacgcctcaacagcagtccaccaggat
tttgtcagagaacagcgcttggttctgcagtcagtccctaacataaaagagaatttctta
caaaattctgagaacaaagcaacaaacaacttaatgatgttagactcgaaatccaagtac
gtcctggacggcatggttgaagccggctgtgaagacctgggaacggacaaaaaagagctg
gccaagctccaaaccgtccagttggatgaagacatgcaagacttataa

DBGET integrated database retrieval system