KEGG   Mus musculus (house mouse): 20475
Entry
20475             CDS       T01002                                 
Symbol
Six5, Dmahp, MDMAHP, TrexBF
Name
(RefSeq) sine oculis-related homeobox 5
  KO
K19474  homeobox protein SIX5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20475 (Six5)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain SINE
    20475 (Six5)
SSDB
Motif
Pfam: SIX1_SD Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 20475
NCBI-ProteinID: NP_035513
MGI: 106220
Ensembl: ENSMUSG00000040841
UniProt: P70178
Position
7:18828469..18832474
AA seq 719 aa
MATSPAEPSAGPAARGEAAAATEEQEEEARQLLQTLQAAEGEAAAAGAGDAAAAADSGSP
SGPGSPRETVTEVPTGLRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERLRGSDPVL
RARALVAFQRGEYAELYQLLESRPFPAAHHAFLQDLYLRARYHEAERARGRALGAVDKYR
LRKKFPLPKTIWDGEETVYCFKERSRAALKACYRGNRYPTPDEKRRLATLTGLSLTQVSN
WFKNRRQRDRTGTGGGAPCKSESDGNPTTEDESSRSPEDLERGVASMAAEAPAQSSIFLA
GATSPATCPASSSILVNGSFLAASSPPAVLLNGSPVIINSLALGENSSLGPLLLTGGSAP
QPQPSLQGVSEAKNSLVLDPQTGEVRLDEAQSEAPETKGVHGTTGEEIPGALPQVVPGPP
PASTFPLTPGAVPAVAAPQVVPLSPSSGYPTGLSPTSPRLNLPQVVPTSQVVTLPQAVGP
LQLLAAGPGSPVKVAAAAGPTNVHLINSSVGVTALQLPSSTAPGNFLLANPVSGSPIVTG
VAVQQGKIILTATFPTSMLVSQVLPPAPSLALPLKQEPAITVPEGALPVGPSPTLPEGHT
LGPISTQPLPPASVVTSGTSLPFSPDSSGLLSSFSAPLPEGLMLSPAAVPVWPAGLELST
GVEGLGTQATHTVLRLPDPDPQGLLLGATTGTEVDEGLEAEAKVLTQLQSVPVEEPLEL
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggctacctcgcctgcggagccgagcgcggggcccgcggctcggggggaggcggcggcg
gcgaccgaggagcaggaggaggaagcgcgccagcttctgcagactctgcaggcagccgag
ggggaggcggcggcggccggggcgggagatgcggcggcggcggcggactctgggtccccg
agtggcccggggtctccccgggagaccgtgaccgaggtgcccactggccttcgcttctcg
cccgaacaggtggcatgcgtgtgcgaggcgctgctgcaggcgggccacgccggccgcttg
agccgcttcctgggcgcgctgcccccggccgagcgcctacgtggcagcgatccggtgctg
cgcgcgcgggccctagtggccttccagcggggtgaatacgccgagctctaccaacttctc
gagagccgccctttccccgccgcccaccacgccttcctgcaggacctctacctgcgcgcg
cgctaccacgaggccgagcgggcccgtggccgtgcgctgggcgctgtggacaaataccgg
ctgcgcaagaagttccctctgcccaagaccatctgggatggcgaggagaccgtctattgc
ttcaaggagcgctcgcgagcggcgctcaaggcctgctaccgcggcaaccgctatcccacg
cctgacgagaagcgccgcctggccacgctcaccggcctctcgcttacacaggtcagcaac
tggttcaagaaccggcgacagcgcgaccgcactgggaccggcggtggagcgccttgcaaa
agcgagtctgatgggaaccccactacggaggatgagtccagccgcagtccagaggacctg
gagaggggtgtggcctccatggctgctgaggcccccgcccagagttccatcttcctggcg
ggggccacctctcctgcaacgtgccctgcctcctcctctatcctagtgaatgggagcttc
ctggccgccagcagtcccccagcagtgctcctcaatggtagcccagtcattatcaatagc
ttggccctaggagagaactccagcttggggcccttgctactcacaggaggaagtgcccct
caaccacagcccagtctccaaggggtcagtgaggccaagaattctctggtcctggaccct
cagacaggagaggttcgactggatgaggctcagtctgaggcccctgagaccaaaggggtt
catgggactactggagaggaaatcccaggagccctgccccaagtagtcccaggcccccca
cctgcctccacctttcctctgaccccgggagctgtgcctgctgtggctgctcctcaggtt
gtaccgctctccccttcttctgggtacccaacaggcctgagccccacctccccacggctg
aacttgccccaggtggtgcccacctctcaggtggtaaccctgcctcaggctgtggggcca
ctccagctgttggcagctgggccaggcagtcctgtgaaggtggcagctgcagcggggcct
accaatgtgcacctgataaactctagtgtgggagtgactgcgctgcaacttccctcgtcc
actgctccaggaaacttcctcctggccaaccctgtgtctggtagccccattgtcactggg
gtagctgtgcagcagggcaagatcatcctcactgccaccttccccaccagcatgctcgtc
tcccaggtcctgcctcctgcccccagtctagccctgcccctgaagcaagagccagctatc
acagtgcctgaaggagctctcccagtgggccccagccccaccctcccagagggtcacact
ctggggccaatctctactcagccactgccacctgcttctgttgtcacctctggcaccagc
ctgcctttctccccggactcctctggcctgctttccagcttctcagcacccctacctgaa
ggtctgatgttgtcacctgcagctgtgccagtctggccagcagggctggaactgagcaca
ggagtagaagggctggggacacaggccacccacactgtgctgaggctgccagaccctgac
ccccagggactgcttctgggggctacaacagggactgaggttgatgaggggctagaagct
gaggccaaggtcctgacccagctgcagtcggtacccgtggaggagcccttggaactgtga

DBGET integrated database retrieval system