KEGG   Mus musculus (mouse): 20480
Entry
20480             CDS       T01002                                 

Gene name
Clpb, AL118244, Skd, Skd3
Definition
(RefSeq) ClpB caseinolytic peptidase B
  KO
K03695  ATP-dependent Clp protease ATP-binding subunit ClpB
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    20480 (Clpb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    20480 (Clpb)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP100
   20480 (Clpb)
SSDB
Motif
Pfam: AAA_2 Ank_2 Ank Ank_5 Ank_3 Ank_4 ClpB_D2-small AAA_5 AAA Sigma54_activat Zeta_toxin AAA_16 Torsin AAA_24 AAA_3 AAA_22 YchF-GTPase_C ATPase_2 RP853 ABC_tran
Other DBs
NCBI-GeneID: 20480
NCBI-ProteinID: NP_033217
MGI: 1100517
Ensembl: ENSMUSG00000001829
Vega: OTTMUSG00000022234
UniProt: Q60649 Q3URM1
Position
7; 7 E2
AA seq 677 aa
MMLSAVLRRTTPAPRLFLGLIKSPSLQSRGGAYGRGVVTGDRGEPQRLRAAAWVRPGASS
TFVPGRGAATWGRRGERTEIPYLTAASSERGPSPEETLPGQDSWNGVPNKTGLGMWALAM
ALVVQCYSKNPSNKDAALMEAARANNVQEVRRLLSEGADVNARHKLGWTALMVASISHNE
SVVQVLLAAGADPNLGDEFSSVYKTANEQGVHSLEVLVTREDDFNNRLNHRASFKGCTAL
HYAVLADDYSIVKELLDRGANPLQRNEMGHTPLDYAREGEVMKLLKTSETKYMEKQRKRE
AEERRRFPLEQRLKEHIIGQESAIATVGAAIRRKENGWYDEEHPLVFLFLGSSGIGKTEL
AKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYIGHEEGGQLTKKLKQCPNAV
VLFDEVDKAHPDVLTIMLQLFDEGRLTDGKGKTIDCKDAIFIMTSNVASDEIAQHALQLR
QEALEMSRNRIAENLGDVQMSDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLP
FCHSELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKHEVERRV
VNQLAAAYEQDLLPGGCTLRITVEDSDKHLLKSPELPSPQAEKRPPTLRLEIIDKDSKTR
KLDIQAPLHPEKVCYTI
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgatgttgtccgcggtgttgaggagaaccacgccagcgcctcggctcttcctagggtta
atcaaatctccatctctccaaagccggggaggtgcttacggccgtggcgttgtcaccgga
gaccgcggggagccgcagcggttgagagctgccgcttgggtgcgccctggagcatcttct
accttcgtccccggacggggggcagccacctgggggcgccgtggagaacgcaccgagatc
ccatacctgactgccgcctcgtcggaacgcggtcctagccccgaagaaacactcccggga
caagacagctggaatggggtccccaacaagacgggtctgggcatgtgggccttggccatg
gcgctggtggttcagtgctacagcaagaatccatccaacaaggatgcagctctaatggaa
gctgcccgggccaataacgtgcaggaagtcagaaggctgttatcagaaggtgcagatgtc
aatgcaagacacaaacttggctggacagcactgatggtggcatccatcagccacaatgag
agtgtggtgcaggtcctgcttgctgctggagctgacccaaaccttggggatgagttcagc
agtgtctacaagactgccaatgaacagggagtccattctctggaagtcctagtcactcga
gaggatgacttcaacaaccggctaaatcaccgtgctagcttcaaaggctgcacagccctg
cactatgctgtcctggccgatgactacagcatcgtcaaggagctgctggacagaggagcc
aacccccttcagaggaatgagatgggacacacacccctggattatgcccgggaaggggag
gttatgaagcttctgaaaacttctgagaccaagtacatggagaagcagaggaagcgggag
gcagaggagcggcgccgcttcccactggagcagcgactgaaggagcacatcattggccag
gagagtgccatcgccaccgtcggtgctgcgatccggaggaaggagaacggctggtacgat
gaggagcaccctctagtcttcctcttcttgggatcgtctggaatagggaaaaccgagctg
gccaagcagacagcaaagtatatgcacaaagatgccaaaaagggcttcatccggctcgac
atgtctgagttccaggagcgacatgaggtagccaagtttatcggttctccaccaggctac
atcggccatgaagagggtggccagctgaccaagaaactgaaacagtgcccaaatgcagta
gtcctctttgatgaggtggacaaggcccatccagatgtgctcaccatcatgctgcagctg
tttgatgagggccgcctgacagatggcaaagggaagaccattgactgcaaggatgccatc
ttcatcatgacttccaatgtagccagtgatgagatcgcccagcatgcattgcagctcaga
caggaagctttggagatgagccgaaatcgaatcgctgaaaaccttggggatgtccagatg
agtgacaagatcaccatctccaagaactttaaagagaatgtgatccgacccatcttgaaa
gctcacttccggagagacgagtttctgggacggatcaatgagatcgtctacttcctccct
ttctgccactcagagctcatccagctggtcaacaaggaactgaacttctgggccaagaga
gccaagcagaggcacaacatcacactactgtgggaccgcgaggtggcagatgtgttggtt
gatggctacaacgtccactatggtgcccgctccattaagcatgaggtagagcggcgtgtg
gtaaaccaactggcggcagcctatgagcaggacctgctaccagggggttgcaccctgcgt
atcactgtggaggattcggacaagcacctcctcaagagccctgagctgccctcaccccag
gctgagaagcgtccacctacattgcgactggagatcattgataaggacagcaagacccgc
aaactggacatccaggcaccactccaccctgagaaggtgtgctacaccatctag

DBGET integrated database retrieval system