KEGG   Mus musculus (mouse): 20495Help
Entry
20495             CDS       T01002                                 

Gene name
Slc12a1, AI788571, D630042G03Rik, Nkcc2, mBSC1, urehr3
Definition
(RefSeq) solute carrier family 12, member 1
  KO
K14425  solute carrier family 12 (sodium/potassium/chloride transporter), member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20495 (Slc12a1)
   04147 Exosome [BR:mmu04147]
    20495 (Slc12a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   20495 (Slc12a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   20495 (Slc12a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SLC12 AA_permease AA_permease_N
Motif
Other DBs
NCBI-GeneID: 20495
NCBI-ProteinID: NP_001073158
MGI: 103150
Ensembl: ENSMUSG00000027202
Vega: OTTMUSG00000015338
UniProt: P55014
Position
2 F1; 2 61.23 cM
AA seq 1090 aa AA seqDB search
MSVSIPSNSVPSSASRFQVHVINEGHGSAAAVGDSADPPHYEETSFGDEAQNRLRISFRP
GNQECYDNFLQTGETAKTDTTFHAYDSHTNTYYLQTMDAVPKIEYYRNTGSVSGPKVNRP
SLLEIHEQLAKNVTVAPGSADRVANGDGMPGDEQAENKEEDMTGVVKFGWVKGVLVRCML
NIWGVMLFIRLSWIVGEAGIGLGVIIIGLSVVVTTLTGISMSAICTNGVVRGGGAYYLIS
RSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVDLLKESDSMMVDPTNDIRIIGSITV
VILLGISVAGMEWEAKAQVILLVILLIAIANFFIGTVIPSNNEKKSRGFFNYQASIFAEN
FGPSFTKGEGFFSVFAIFFPAATGILAGANISGDLEDPQDAIPRGTMLAIFITTVAYIGV
AICVAACVVRDATGSMNDTIVSGMNCNGSAACGLGYDFSRCQHEPCQYGLMNNFQVMSMV
SGFGPLITAGIFSATLSSALASLVSAPKVFQALCKDNIFKGLQFFAKGYGKNNEPLRGYF
LTFVIAMAFILIAELNVIAPIISNFFLASYALINFSCFHASYAKSPGWRPAYGIYNMWVS
LFGAILCCAVMFVINWWAAVITYVIELFLYIYVTYKKPDVNWGSSTQALSYVSALDNALE
LTTVEDHVKNFRPQCIVLTGGPMTRPALLDITHAFTKNSGLCICCEVFVGPRKLCVKEMN
SGMAKKQAWLIKNKIKAFYAAVAADCFRDGVRSLLQASGLGRMKPNTLVIGYKKNWRKAP
LSELENYVGIIHDAFDFEIGVVIVRISQGFDISPVLQVQDELEKLEQERLALEAAIKDNE
CEEGKGGIRGLFKKAGKLNITKPAPKKDGNISSIQSMHVGEFNQKLVEASAQFKKKQGKG
TIDVWWLFDDGGLTLLIPYILTLRKKWKDCKLRIYVGGKINRIEEEKISMASLLSKFRIK
FADIHIIGDINIKPNKESWKVFEEMIEPYRLHESHKDLTTAEKLKRESPWKITDAELEAV
KEKSYRQVRLNELLQEHSRAANLIVLSLPVARKGSISDLLYMAWLEILTKNLPPVLLVRG
NHKNVLTFYS
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcagcatcccttccaactcagtgcccagtagtgccagtcgctttcaggtccat
gttataaacgagggccatggcagtgcggcagccgtgggcgacagtgcagaccccccacat
tatgaagagacctctttcggggacgaagcccaaaacagactgagaatcagctttaggcct
gggaatcaggagtgctatgacaattttctccaaactggagagactgccaaaacagacacc
acgtttcacgcctacgactctcacacaaacacatactacctacaaaccatggacgccgtc
cccaagattgaatactaccgcaacacaggcagcgtgagcgggcccaaggtcaaccggccc
agcctgctggagatccacgagcagctggctaagaatgtgactgtggcccctggttcagct
gacagggttgctaatggagatgggatgcctggagatgagcaagcagaaaacaaggaagaa
gacatgactggagttgtgaagtttggatgggtgaaaggtgtgctggtgcgatgcatgctg
aacatctggggagtcatgctcttcattcgcctctcctggattgtaggagaagcgggaatt
ggtctgggcgtcatcatcattggcctgagcgtagttgtgacaacactcacaggtatttct
atgtcggctatttgcacaaacggagtggtgcgaggaggtggagcctactacctgatttcc
cggagcttagggcctgagttcggtgggtcaataggcttgatctttgcttttgccaatgca
gtggctgtcgctatgtatgtggtgggattcgcggagactgtcgtggatcttcttaaggag
agcgattcaatgatggtggatccaaccaatgacatccgcatcatcggttccatcaccgtg
gtgattcttctaggaatctcagtagctgggatggagtgggaagcaaaggctcaagtcatt
ctcctggtcattcttctcattgccattgcaaacttcttcattggaactgtcatcccatcc
aacaatgagaagaaatccagaggcttctttaactaccaagcatctatatttgcggaaaac
tttgggccaagcttcacaaagggggaaggcttcttctcggtctttgccatctttttccca
gctgctactgggattcttgctggtgccaacatctctggagacctggaggatccccaggac
gccatccccagagggaccatgctggccatcttcatcaccaccgtggcctacataggtgtt
gctatttgcgtagccgcctgtgtggtccgagatgccactggcagcatgaatgacaccatc
gtttctgggatgaattgcaatggctctgcggcctgtgggttgggctacgacttctcaaga
tgtcaacacgagccatgtcagtatgggctgatgaacaatttccaggtcatgagcatggtg
tccgggttcgggcccctcatcactgcagggatcttttcggcaacactgtcttccgccctg
gcctccctcgtcagtgcgcccaaagtattccaggctctgtgcaaggacaacatcttcaaa
ggactgcagttcttcgcaaagggctatgggaaaaacaacgagcccctgagagggtacttc
ctcacttttgtgatagccatggcattcattctcatcgccgagctgaatgtcattgccccc
atcatctccaacttcttcctggcctcatatgcgcttattaatttctcctgtttccatgcc
tcgtatgccaaatctccaggatggaggcctgcatatgggatttacaacatgtgggtatct
ctttttggagcgattttgtgctgtgcagtcatgtttgtcatcaactggtgggcagctgtc
atcacttatgtcattgagttattcctctatatctatgtgacttataagaagccagatgtg
aactggggctcctccacacaggctctgtcctatgtgagtgctttagacaacgctctggaa
ttaaccacagtggaagaccatgtgaaaaacttcagaccccagtgcattgtcttaacaggc
ggacccatgactagacccgctctcttggatataacccacgcctttacgaagaatagtggc
ctctgcatctgctgcgaagtcttcgtgggacctcgcaagctgtgtgttaaagagatgaac
agcggcatggctaaaaaacaggcctggcttataaagaacaaaatcaaagctttttatgct
gcagtggctgcagactgcttcagggacggtgtccggagcctccttcaggcctcaggcttg
gggagaatgaagccaaacactctcgtgattggatacaaaaagaactggaggaaagctccc
ttgtcagagctggagaactacgtgggaatcatacatgacgcctttgactttgagattggc
gtggtcatagtcagaatcagccaaggctttgacatctctccggttctccaggtacaagac
gaactggagaaactggaacaggagagattggctctggaggccgcaatcaaagacaacgag
tgtgaggagggcaaggggggcatccgaggcttgtttaagaaggccggcaagctgaacatt
accaagccagcccccaagaaagacggcaacatcagcagcatccagtcaatgcacgtcggg
gagttcaatcagaaactggtggaagccagcgctcagtttaaaaagaagcagggaaaaggc
acgattgatgtttggtggttatttgatgatggagggttaacactgcttatcccatatatc
ttgactctcagaaaaaaatggaaagattgtaagttaagaatctatgttggaggaaagatc
aaccgcatcgaagaggaaaaaatttcaatggcttcacttctcagcaaatttagaataaaa
tttgcagacatccatataattggagacatcaacattaagccaaacaaagagagctggaaa
gtctttgaagagatgattgaaccttatcggcttcatgaaagccacaaagatttgaccact
gctgagaaattaaaaagagaaagtccatggaaaattacagatgcagaactggaagcagtc
aaggaaaagagttaccgtcaagttcgactgaacgagctcttacaggaacactccagagcc
gccaacctcatcgtgttgagccttccagtggcaagaaaaggatctatttcggatttgttg
tacatggcgtggttagaaatcctgaccaagaaccttcctcctgtgttactggttagagga
aatcacaaaaatgtcttaacattttactcttaa

DBGET integrated database retrieval system