KEGG   Mus musculus (house mouse): 20498
Entry
20498             CDS       T01002                                 
Symbol
Slc12a4, AW546649, KCC1, RBCKCC1
Name
(RefSeq) solute carrier family 12, member 4
  KO
K14427  solute carrier family 12 (potassium/chloride transporter), member 4/6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20498 (Slc12a4)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   20498 (Slc12a4)
SSDB
Motif
Pfam: AA_permease SLC12 AA_permease_2
Other DBs
NCBI-GeneID: 20498
NCBI-ProteinID: NP_033221
MGI: 1309465
Ensembl: ENSMUSG00000017765
UniProt: Q9JIS8 Q3TWZ6
Position
8:complement(106670222..106692781)
AA seq 1085 aa
MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAEREDSDGQGNHRENSPFLCPLDASRGND
YYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGT
LMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVV
PAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFYPSGT
HDMSSATLNNMRVYGTIFLTLMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIF
DPPVFPVCMLGNRTLSRDQFDICAKTVVVDNETVATRLWTFFCHSPNLTADSCDPYFLLN
NVTEIPGIPGAAAGVLQENLWSAYLEKGEVVEKHGLPSTDTLGLKESLSLYVVADIATSF
TVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGV
VLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIP
FLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQT
LLRTPNWRPRFKYYHWTLSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKE
WGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKA
GKGLTIVGSVIQGSFLESYGEAQAAEQTIKNMMDIEKVKGFCQVVVASKVREGLAHLIQS
CGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHER
YLDGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDDNSIQMKKDLAIFLY
HLRLEAEVEVVEMHNSDISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRHSAL
RLESLYSDEEEESVAGADKIQMTWTRDKYMAEPWDPSHAPDNFRELVHIKPDQSNVRRMH
TAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREV
ITIYS
NT seq 3258 nt   +upstreamnt  +downstreamnt
atgcctcacttcaccgtggtgccggtggacgggccgcgacgcggcgactatgacaacctc
gaggggctcagttgggtggactacggcgagcgcgccgagcgggaagactcggacggacag
ggtaaccacagagagaatagccctttcctttgccctttggacgcctccagaggaaatgac
tactatgaccggaacttggcactgtttgaggaggagctggacatccgcccaaaggtgtca
tctctcctgggcaagcttgtcagctataccaacctcacccaaggagccaaggagcacgag
gaggctgagagtggagaaggtggccgacggagagctgccaaggctcccagcatgggcaca
ctcatgggagtgtacctgccctgcctgcagaatatctttggggtcatcctcttcctgcgg
ctgacctggatggtgggcacagctggtgtgctgcaggctctcctcattgtcctcatctgc
tgctgctgtaccctgctgacagccatctccatgagcgccattgccaccaacggcgtggtt
ccagctggtggctcgtacttcatgatttcccgctctttgggaccagaattcggaggtgct
gtgggcctgtgcttctacctggggacgacatttgcagcagccatgtatatcctaggggcc
attgagatcttgctgacctacattgctccgccagctgccatcttttacccatcgggcacc
catgacatgtcaagcgccaccttgaataacatgagagtgtatgggaccattttcctgact
ctgatgaccctagtggtgtttgtcggtgtcaagtacgtgaacaagtttgcctcgctcttc
ctggcctgcgtgatcatctccatcctttccatttacgcgggaggcatcaagtccattttt
gaccctcccgtgtttccggtgtgtatgctgggcaataggaccctgtctcgggaccagttt
gacatctgtgccaagacagtcgtggtggacaatgagacagtggccacccggctgtggact
ttcttctgccacagccccaaccttactgctgactcctgtgacccctacttcctgctcaac
aatgtgacagagattcctggcatacctggggcagctgctggtgtgctccaggagaacctc
tggagcgcttacctggagaagggggaggtcgtggagaagcatgggctgccgtccacagac
accctcggcctaaaggagagcctgtccctgtatgtggtggctgacatcgccacgtccttc
accgtgctggttggcatctttttcccttctgtgacaggcatcatggctggttcaaaccgc
tccggggatctccgtgacgcccagaagtctatcccagtggggaccattctggccattgtt
accacttcgctggtgtacttcagcagtgtgatcctcttcggtgcctgcatcgagggtgtg
gtactccgggacaagtacggtgatggcgtcagcaggaacctggtggtgggcaccctggcc
tggccttcgccttgggtcatcgtggttggctccttcttctcaacatgtggggctggtctc
cagagcctcactggggcgccacgtttactgcaagccattgccaaggataacatcatcccc
ttcctccgggtgtttggccatgggaaagcaaacggtgaaccgacgtgggccctcctcctg
acagcgctcatcgctgagctgggcatcctgattgcttcccttgacatggtggcccccatt
ctgtccatgttctttctgatgtgttacctctttgtaaacttggcctgtgccgtgcagaca
cttctgaggacccccaactggcggccccggttcaagtactatcactggacattgtctttc
ctaggcatgagtctctgcctggctcttatgtttgtctcctcctggtactatgccctagtg
gccatgctcatcgcaggcatgatctacaagtacatcgagtaccaaggggccgagaaggag
tggggcgatgggatccgaggcctgtccctgagtgcggcacgctatgcactgctgaggctg
gaggaagggcctcctcacaccaagaactggcggcctcagctcctggtgctgcttaagtta
gacgaagatcttcatgtgaagtacccccggctcctcaccttcgcctcccagctgaaggcc
gggaagggcctgacaatcgttggctctgtcatccagggcagctttctggagagctatggt
gaagcccaggccgctgagcagaccatcaagaacatgatggacattgagaaagtcaaaggc
ttctgccaggtagtggtggccagcaaggttcgagagggactggcccacctcatccagtct
tgcggcctgggcggcatgagacacaactccgtggtgctgggctggccctatggctggcga
cagagtgaggacccacgtgcctggaagacctttattgacactgtgcgctgcaccacagct
gcccacctggccctgctggtgccaaagaacatagctttctaccccagcaaccacgagcgc
tacctggatggccatatcgacgtgtggtggatcgtgcatgatggaggcatgcttatgctg
ctgccctttctgctgcgccagcataaggtttggaagaagtgccggatgcgcattttcacc
gtggcccagatggatgacaacagcatccagatgaagaaggatctggccatcttcctgtat
cacctccgcctggaagctgaagtggaggtggtagagatgcacaacagtgacatctctgcc
tatacctatgagcggacactgatgatggagcagcggtctcagatgctgcggcagatgagg
ttgaccaaaactgagcgggatcgagaggcccagctggtaaaggacaggcactcggctctt
aggctggagagcctctactccgacgaggaggaagagtctgtggcaggggccgacaagatc
cagatgacgtggaccagagacaagtacatggctgagccctgggaccccagccacgcccct
gacaacttccgggagctggtgcacattaagccggaccagtccaacgtgcggcgcatgcac
actgctgtgaagctcaacgaggtcattgtcacgcgctcccacgatgcccgtctggttttg
ctgaacatgcctggcccccctaagaacagcgagggcgacgagaactacatggaattcctt
gaagtcctaaccgagggccttgaacgggtgttgttggtgcgtggcggcggccgggaagtc
atcaccatctattcctga

DBGET integrated database retrieval system