KEGG   Mus musculus (mouse): 20503Help
Entry
20503             CDS       T01002                                 

Gene name
Slc16a7, 4921534N07Rik, 9030411M13Rik, D630004K10Rik, Mct2
Definition
(RefSeq) solute carrier family 16 (monocarboxylic acid transporters), member 7
  KO
K08184  MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20503 (Slc16a7)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC16: Monocarboxylate transporter
   20503 (Slc16a7)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Monocarboxylate porter (MCP) family [TC:2.A.1.13]
    20503 (Slc16a7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Sugar_tr TMEM100
Motif
Other DBs
NCBI-GeneID: 20503
NCBI-ProteinID: NP_035521
MGI: 1330284
Ensembl: ENSMUSG00000020102
Vega: OTTMUSG00000060295
UniProt: O70451 Q149G3
Position
10; 10 D3
AA seq 484 aa AA seqDB search
MPSEPSAPLPQPLPPDGGWGWVVVCASFISIGFSYAFPKAVTVFFKDIQEIFNTTSSQIA
WISSIMLAVMYAGGPISSVLVNNYGSRPVVIVGGLLCCIGMILASYSNSVIELYLTVGFI
GGLGLAFNLQPALTIIGKYFYRRRPLANGCAMAGSPVFLSTLAPFNQYLFNNYGWKGSFL
ILGGIFLHSCVAGCLMRPVGPSPNTKKSKSKVGSRHDSTLKKASKVSTAQKVNRFLDFSL
FMHRGFLIYLSGNVILFLGIFAPIIFLAQYAKHIGVDDYNSAFLLSVMAFIDMFARPSVG
LIANTSLIRPRIQYLFSSAIIFTGICHLLCPLATTYSALVVYVVFFGLGFGSISSLLFEC
LMDIVGATRFSSAVGLTTIVECCPVLFGPPLAGKLLDITGEYKYLYIASGTVVLVSGTYL
LIGNAINYRLLDKERKREKAKKKKSASHASREMEALNRSKQDEVTVKASNAHNPPSDRDK
ESNI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagagccttccgcgccgcttccacaaccacttcctcccgacggagggtggggc
tgggtcgtagtctgtgcgtcctttatctccattggattttcatatgccttccccaaagct
gtcacagtattcttcaaagacatccaggaaatattcaacaccacctccagtcagatcgct
tggatatcgtccatcatgctagctgtcatgtatgcgggaggtcccatcagtagtgtgttg
gtgaataactatggcagccggcctgtggtgatagtgggaggactattatgctgcattgga
atgatcttggcttcttacagcaacagcgtgatagagctttatctcaccgttggcttcatt
ggaggtttaggattagcattcaacctgcaaccagccttaacaataattggaaaatacttc
tatagaagacgaccacttgcaaatggctgcgccatggctggaagtcctgttttcttaagc
acactggctcctttcaatcagtacctatttaacaactatggctggaaggggagttttttg
attttgggaggtatatttttgcactcctgtgtggctgggtgcctcatgagacctgttggg
ccaagtccaaatactaagaagtctaaaagtaaggttggctcaagacatgattcaactctg
aagaaagccagtaaggtatcaacagcacaaaaggttaataggtttttagatttcagcctt
tttatgcatagaggatttttgatctacctatctggaaacgtcatattgtttttagggatt
tttgcccctattatattcttggctcagtacgctaaacacataggagtggatgactataac
tcagcttttttactgtctgtgatggcttttattgatatgtttgctcggccttctgtagga
ttaatagccaacactagcttaatccgtccacgaatccagtacctcttcagctctgcaatc
atctttactggcatatgccatctcttatgccccctagcaactacctactcagctttggtg
gtctacgttgtattttttggattgggatttggaagtattagcagtctcctctttgaatgc
cttatggacattgttggagctaccaggttctccagtgctgtgggactcacaacaatcgtg
gagtgttgtccagttcttttcggccctcctctggctggtaaattgcttgatataactgga
gaatataaatacctgtacatagccagcggaacagtcgtgttagtatcaggtacttacctc
ctgattggcaatgctataaactatagacttctcgacaaggaaaggaagagagagaaggca
aagaagaagaagtcagcttcacacgcgtccagagaaatggaggccctgaacagatctaaa
caggacgaagttactgtcaaagcttcaaacgcacacaatcctccctcagacagggacaaa
gagagtaatatttaa

DBGET integrated database retrieval system