KEGG   Mus musculus (mouse): 20505
Entry
20505             CDS       T01002                                 

Symbol
Slc34a1, N, NaPi-IIa, Np, Npt2, Npt2a, Slc1, Slc17a2
Name
(RefSeq) solute carrier family 34 (sodium phosphate), member 1
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    20505 (Slc34a1)
  09154 Digestive system
   04978 Mineral absorption
    20505 (Slc34a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20505 (Slc34a1)
   04147 Exosome [BR:mmu04147]
    20505 (Slc34a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   20505 (Slc34a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   20505 (Slc34a1)
SSDB
Motif
Pfam: Na_Pi_cotrans
Other DBs
NCBI-GeneID: 20505
NCBI-ProteinID: NP_035522
MGI: 1345284
Ensembl: ENSMUSG00000021490
UniProt: Q9D2V6
Position
13 B1; 13 29.81 cM
AA seq 637 aa
MMSYSERLGGPAVSPLPVRGRHMVHGATFAYVPSPQVLHRIPGTSTYAISSLSPVTLTEH
SCPCGEVLECHDPLPTKLAQEEEQKPEPRLSQKLAQVGTKLLKVPLMLAFLYLFVCSLDV
LSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLE
VSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAA
TGYLHHVTGLVVASFNIRGGRDAPDLLKVITEPFTRLIIQLDKSVITSIAVGDESLRNHS
LIRIWCHPDTTEASTSMSRVEAIGSLANTTMEKCNHIFVDTGLPDLAVGLILLAGSLVVL
CTCLILLVKMLNSLLKGQVANVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVF
TSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSSFQIALCHFFFNI
SGILLWYPLPCTRLPIRMAKALGKRTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQAMV
GVGTPFGALLAFVVLVNVLQSRSPGHLPKWLQTWDFLPRWMHSLQPLDGLITRATLCYAR
PEPRSPQLPPRVFLEELPPATPSPRLALPAHHNATRL
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgatgtcctacagcgagagattggggggaccggctgtctccccacttccagtccgtggg
agacacatggtgcatggggcaacctttgcttatgtgcccagcccacaagtcctgcacagg
attcctggaacatccacctatgccatctccagtctgagcccggtcaccctcacagagcac
agctgtccctgtggggaagtcctggaatgtcatgacccactacctaccaagctggctcag
gaagaggagcaaaagccagagcccaggctgtcccagaagcttgcccaggttggcacgaag
ctcctgaaggtgcctctgatgctggctttcctttacctctttgtctgctccctggatgtg
ctcagctccgccttccagttggctggagggaaggtggctggggacatcttcaaggacaat
gccatcctatccaacccagtggcagggctggtggtggggatcctggtgacagttctggtg
cagagttccagtacctctacatccatcattgtcagcatggtctcctccggcttgttggag
gtgagctccgccattccgatcatcatgggctccaacatcggaacctctgtcaccaacacc
attgtggccctgatgcaggcaggggacaggactgacttcaggcgggcttttgcaggggcg
accgtgcatgactgttttaactggctgtctgttctggtcctactgcccctggaggctgcc
acgggctacctacaccatgtcaccgggcttgtggttgcttccttcaacatccgaggtggc
cgtgatgcccccgaccttctcaaagtcatcacagagcccttcacaagactcatcatccag
ctggacaagtctgtgatcaccagcattgccgtgggggatgagtccctgaggaatcacagt
ctcattcggatttggtgtcacccagacacaacagaggcttccacttctatgtccagggta
gaggccatcggcagccttgcaaacaccaccatggagaaatgcaaccatatcttcgtggat
acggggctgcccgacctggccgtggggctcattctgctggcgggctccctggtggttctc
tgcacttgtcttatcctccttgtgaagatgctcaactccctgctcaagggccaagtggcc
aatgtcatccagaaggtcatcaacacagactttcctgcccccttcacctgggtcacgggc
tactttgccatggtggtgggtgccagcatgacctttgttgtccagagcagctccgtgttc
acctcagccatcaccccactcattggcctgggtgtgatcagcattgagcgggcctaccct
ctcaccctgggctccaacattggcactaccactacagccatcctggcagcgcttgccagc
cccagggagaagctatccagctcatttcagattgccctctgccacttcttcttcaacatc
tcgggcatcctactgtggtacccgctgccctgcacacgcctgcccatacgcatggccaag
gccctgggcaaacgcaccgccaagtaccgctggtttgctgtcctctacctgctcgtgtgc
ttcctgctcttgccctcgctggtgtttggcatttccatggcaggctggcaggctatggtc
ggagtgggcacgccctttggggctctactggcctttgtggtgcttgttaatgtcctgcag
agccgaagtcccgggcacctccccaagtggctgcagacatgggacttcctacctcgctgg
atgcactctttgcagcccctggatggccttatcacaagagccaccttgtgttatgccagg
cccgagccccgttcaccccaacttccccctagagtcttcctggaggagcttcccccagcc
acgccctccccccgcctggcactgcctgctcaccacaatgccacccgtctctag

DBGET integrated database retrieval system