KEGG   Mus musculus (mouse): 20508
Entry
20508             CDS       T01002                                 

Symbol
Slc18a3, V, VAC, VAChT, VAT
Name
(RefSeq) solute carrier family 18 (vesicular monoamine), member 3
  KO
K14636  MFS transporter, DHA1 family, solute carrier family 18 (vesicular acetylcholine transporter), member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    20508 (Slc18a3)
   04721 Synaptic vesicle cycle
    20508 (Slc18a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20508 (Slc18a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   20508 (Slc18a3)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    20508 (Slc18a3)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Other DBs
NCBI-GeneID: 20508
NCBI-ProteinID: NP_068358
MGI: 1101061
Ensembl: ENSMUSG00000100241
Vega: OTTMUSG00000049703
UniProt: Q3TYJ1
Position
14 B; 14 19.4 cM
AA seq 530 aa
MEPTAPTGQARAAATKLSEAVGAALQEPQRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
IAHMRGGSESPTLISEVWEPTLPPPTLANASAYLANTSASPTAAGSARSILRPRYPTESE
DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVMFAFAEDYATLFA
ARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAG
KRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTT
CNIPLAFLEPTIATWMKHTMAASEWEMGMVWLPAFVPHVLGVYLTVRLAARYPHLQWLYG
ALGLAVIGVSSCVVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV
YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRS
ERDVLLDEPPQGLYDAMRLREVQGKDGGEPCSPPGPFDGCEDDYNYYSRS
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggaacccaccgcgccaaccggtcaggcccgggcggcggccaccaagctgtcggaagca
gtgggagccgcgctacaagagccccagaggcagcggcgcctggtgctggtcatcgtgtgc
gttgcactgttactggacaacatgttgtacatggtcatcgtgcccattgttcccgactat
atcgctcacatgcgcgggggcagcgagagccctaccctgatctctgaggtgtgggaaccc
accctgccgccgcccactctggctaatgccagcgcctacttggccaacacctcggcgtcc
ccgacggctgccgggtcggctcggtcaatcctgcggcctcgctaccccacagaaagtgaa
gatgtgaagataggcgtgctatttgcctccaaggccatcctgcagcttctggtgaacccc
ttaagcgggcctttcattgatcgcatgagctacgacgtgccgctgcttattggcctgggc
gtcatgttcgcctccacagtcatgtttgcctttgcagaagactatgccacgctcttcgct
gcgcgcagtctacaaggcctgggctcagccttcgcggacacgtctggcattgccatgatc
gccgacaagtatcccgaggagcctgagcgcagtcgtgctctgggcgtggcgctagccttc
atcagctttggaagcctagtggcgccaccgtttgggggcatcctctacgagttcgcgggc
aagcgtgtaccctttctagtgctcgccgccgtgtcgctcttcgacgcactcctactcctg
gcggtggctaagcctttctcagctgcggctcgggcgcgggccaacctgcccgtgggcaca
cctatccatcgcctcatgctagacccttacatcgctgttgtagccggagcgctcacaact
tgtaacattccccttgcgtttctcgagcccaccatagccacgtggatgaagcacacaatg
gcggcatccgagtgggagatgggcatggtttggctgccggctttcgtgccacacgtgtta
ggcgtctatctcaccgtgcgtctagcggcgcgctatccacacctgcagtggctgtatggc
gctctcgggctagcggtaatcggagtgagctcttgcgtcgtacctgcctgccgatccttc
gcgcccttagtggtctcgctctgcggcctctgcttcggcatcgcgttggtggacacggcg
ctcctacccacgctcgcctttctggtggacgtgcgccacgtatcagtctatggcagtgtc
tatgccatagctgacatctcctattctgtggcctacgctctcgggcccatagtagcaggc
catatcgttcactcacttggctttgagcagctcagccttggcatgggcctggccaacctg
ctctacgcaccggtcctattgctcttgcgtaatgtgggcctccttacacgctcgcgttcc
gagcgcgatgtgctgcttgatgaaccgccgcagggtctgtacgacgcgatgcgcctgcgt
gaggtgcagggcaaggacggcggtgaaccttgtagcccgcctggcccttttgatggctgt
gaggacgactacaactactactcccgcagctag

DBGET integrated database retrieval system