KEGG   Mus musculus (mouse): 20511
Entry
20511             CDS       T01002                                 

Gene name
Slc1a2, 1700091C19Rik, 2900019G14Rik, AI159670, Eaa, Eaat2, GLT, GLT-, GLT-1, GLT1, MGLT, MGLT1
Definition
(RefSeq) solute carrier family 1 (glial high affinity glutamate transporter), member 2
  KO
K05613  solute carrier family 1 (glial high affinity glutamate transporter), member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04724  Glutamatergic synapse
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    20511 (Slc1a2)
   04721 Synaptic vesicle cycle
    20511 (Slc1a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    20511 (Slc1a2)
   05016 Huntington disease
    20511 (Slc1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20511 (Slc1a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   20511 (Slc1a2)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 20511
NCBI-ProteinID: NP_001070982
MGI: 101931
Ensembl: ENSMUSG00000005089
Vega: OTTMUSG00000014848
UniProt: P43006 Q3UYK6
Position
2 E2; 2 54.13 cM
AA seq 572 aa
MASTEGANNMPKQVEVRMHDSHLSSDEPKHRNLGMRMCDKLGKNLLLSLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDGMN
VLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKII
AIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGT
ASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILD
GGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSV
NVVGDSFGAGIVYHLSKSELDTIDSQHRMQEDIEMTKTQSIYDDKNHRESNSNQCVYAAH
NSVVIDECKVTLAANGKSADCSVEEEPWKREK
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggcatcaacagagggtgccaacaatatgcccaagcaggtagaagtgcgcatgcatgac
agccacctcagctccgatgagccaaagcaccgaaacctgggcatgcgcatgtgcgacaag
ctggggaaaaatctcctgctctcactgactgtgtttggtgtcatcctgggagcagtgtgt
ggcgggctgcttcgcttggcatcgcccatccaccctgatgtggtcatgttgatagccttc
ccgggggacatactcatgaggatgctgaagatgctcatcctccctcttatcatctccagt
ttaatcacagggttgtcaggcctggatgctaaagccagcggccgcctaggcacgagagct
atggtgtattacatgtccacgaccatcattgccgccgtgctgggggtcatcctggtgttg
gccatccacccaggcaatcccaaactcaagaagcagctagggcccgggaagaagaacgac
gaggtgtctagcctggatgccttcctggatctcattagaaatctcttcccggagaacctg
gtgcaagcctgtttccagcagattcagacagtgacaaagaaagttctggtggcacctcca
tctgaggaggccaataccaccaaggcggtcatctccatgttgaatgaaaccatgaacgag
gcccctgaagaaactaagatcgttatcaagaagggcctggagttcaaggacgggatgaac
gtcttaggtctgatcggattctttattgctttcggcattgccatggggaagatgggtgaa
caggccaagctgatggtggagttcttcaacattctgaatgagatcgtgatgaagttagtg
atcatgatcatgtggtactcccctctgggtatcgcctgcttgatttgtgggaagatcatc
gccatcaaggacttagaagtggttgctaggcagctggggatgtacatgatcaccgtgatc
gtgggcctcatcattcacgggggcatctttctccccttgatttactttgtagtgaccaga
aaaaatccattctccttttttgctggcatattccaagcctggatcactgctctgggaact
gcttccagtgctggaactttgcctgttaccttccgttgcttggaagataatctagggatt
gacaagcgtgtgaccagattcgtcctcccagtcggagcaaccattaacatggatggcaca
gccctttacgaggctgtggcagccatcttcatagcccaaatgaatggggtcatcttggat
ggaggtcagattgtgactgtaagccttacagccaccctggcgagcattggtgcagccagt
attcccagcgccgggctggtcaccatgctcctcattctcacagctgtgggcctgccaacg
gaggatatcagtctgctggtggcggtggactggctgctggatagaatgagaacttcagtc
aatgtggtgggcgattcttttggggctgggattgtctatcacctttccaagtctgagctg
gacaccattgactcccaacaccgaatgcaggaagacatcgaaatgaccaagacgcagtcc
atttacgacgacaagaaccacagggaaagcaactctaatcagtgtgtctatgccgcacac
aactctgtcgtaatagatgagtgcaaggtaactctggcggccaatggaaagtcagctgac
tgcagtgttgaggaagaaccttggaaacgtgaaaaataa

DBGET integrated database retrieval system