KEGG   Mus musculus (mouse): 20512
Entry
20512             CDS       T01002                                 

Gene name
Slc1a3, AI504299, B430115D02Rik, Eaa, Eaat1, GL, GLAST, GLAST-1, GLU-T, GluT-1, Gmt1, MGluT, MGluT1
Definition
(RefSeq) solute carrier family 1 (glial high affinity glutamate transporter), member 3
  KO
K05614  solute carrier family 1 (glial high affinity glutamate transporter), member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04724  Glutamatergic synapse
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    20512 (Slc1a3)
   04721 Synaptic vesicle cycle
    20512 (Slc1a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    20512 (Slc1a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20512 (Slc1a3)
   04147 Exosome [BR:mmu04147]
    20512 (Slc1a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   20512 (Slc1a3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   20512 (Slc1a3)
SSDB
Motif
Pfam: SDF MT Yip1
Other DBs
NCBI-GeneID: 20512
NCBI-ProteinID: NP_683740
MGI: 99917
Ensembl: ENSMUSG00000005360
Vega: OTTMUSG00000032639
UniProt: P56564 Q543U3
Position
15 A1; 15 3.82 cM
AA seq 543 aa
MTKSNGEEPRMGGRMERLQQGVRKRTLLAKKKVQSLTKEDVKSYLFRNAFVLLTVTAVIV
GTILGFALRPYKMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMYREGKIVQVTAADAFLDLIRNMFPP
NLVEACFKQFKTSYEKRSFKVPIQSNETLLGAVINNVSEAMETLTRIREEMVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPLGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEALAAIFIAQVNNFD
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNEPEKPVADSE
TKM
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgaccaaaagcaacggagaagagcctaggatggggggcaggatggagagattgcagcaa
ggggtccgcaagcggacacttctggccaagaagaaagttcagagcctcaccaaggaagat
gttaagagttacctgtttcggaatgccttcgttctgctcacggtcactgctgtcattgtg
ggtacaatccttggatttgccctccgaccgtataaaatgagctaccgggaggtgaagtac
ttttcgttccctggggagcttctcatgaggatgctgcagatgctggtcttgcccctgatc
atctccagtctcgtcacaggaatggcggccctagatagtaaggcatccgggaagatgggg
atgcgcgctgtagtctattacatgactactaccatcattgctgtggtgattggcataatc
attgtcatcatcatccaccccggaaagggcacaaaggaaaacatgtacagagaaggtaaa
atcgtgcaggtcactgcagcagatgccttcctggatttgatcaggaacatgttccctccc
aatctggtagaagcctgctttaaacagtttaaaaccagctacgagaaaagaagctttaaa
gtgcctatccagtccaacgaaacacttctgggcgccgtgatcaacaacgtgtcagaggcc
atggagactctgacccggatccgggaggagatggtgcccgtgcctggatctgtgaatggg
gtcaatgccctgggcctagttgtcttctccatgtgcttcggtttcgtgatcggaaacatg
aaggagcaggggcaagcgctgagagagttctttgattctcttaacgaagccatcatgcga
ttggtcgcggtgataatgtggtatgcgcctctgggcatcctcttcttgatcgcagggaag
attgttgagatggaagacatgggtgtgattgggggacagcttgccatgtacaccgtgaca
gtcattgtcggcctcctcattcacgccgtcatcgtcctgcctctcctctacttcctggta
acccggaagaacccctgggttttcattggagggttgctgcaagcgctcatcacagccctt
gggacctcctcaagttctgccaccctacccatcactttcaagtgcctggaagagaacaat
ggtgtggacaaacgcatcaccagatttgtgctccccgtgggggccaccattaacatggat
gggaccgccctctacgaggctttggctgccattttcatcgctcaagtgaacaactttgac
ctgaactttggacagattataacaataagcatcacagccacggccgcaagcatcggggca
gccgggattcctcaggccggtctggtcaccatggtcatcgtgctgacatctgtgggcctg
cccacagatgacatcacactcatcattgcagtggactggtttctggaccgcctccgaacc
accaccaacgtactgggtgactccctcggagcagggattgtcgagcacttgtcccgacat
gaactgaagaaccgagatgttgaaatggggaactcggtgattgaggagaacgaaatgaag
aagccgtatcagctgattgcccaggacaatgaaccggagaaacccgtggcagacagcgaa
accaagatgtag

DBGET integrated database retrieval system