KEGG   Mus musculus (mouse): 20513Help
Entry
20513             CDS       T01002                                 

Gene name
Slc1a6, EAAT4
Definition
(RefSeq) solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
  KO
K05617  solute carrier family 1 (high affinity glutamate/aspartate transporter), member 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    20513 (Slc1a6)
   04721 Synaptic vesicle cycle
    20513 (Slc1a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20513 (Slc1a6)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   20513 (Slc1a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SDF
Motif
Other DBs
NCBI-GeneID: 20513
NCBI-ProteinID: NP_033226
MGI: 1096331
Ensembl: ENSMUSG00000005357
UniProt: O35544 B2RQX4 Q3TXM3
Position
10 C1; 10 39.72 cM
AA seq 561 aa AA seqDB search
MSSHGNSLFLRESGAGGGCLQGLQDSLQQRALRTRLRLQTMTREHVRRFLRRNAFILLTV
SAVIIGVSLAFALRPYQLSYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMASLDNKA
TGRMGMRAAVYYMVTTVIAVFIGILMVTIIHPGKGSKEGLHREGRIETVPTADAFMDLVR
NMFPPNLVEACFKQFKTQYSTRVVTRTIVRTDNGSELGASMSPTSSVENETSILENVTRA
LGTLQEVISFEETVPVPGSANGINALGLVVFSVAFGLVIGGMKHKGRVLRDFFDSLNEAI
MRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGLFLHAGGVLPLIYF
LVTHRNPFPFIGGMLQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLPVGATVN
MDGTALYEALAAIFIAQVNNYELNLGQITTISITATAASVGAAGIPQAGLVTMVIVLTSV
GLPTEDITLIIAVDWFLDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLGKPY
KSLMAQEKGASRGRGGNESVM
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccacggcaatagtctgttcctgagggagagcggtgccggtgggggctgtctg
cagggcctgcaggacagcctgcagcagagagcactgcgcacgcgcttgcgcctgcagacc
atgacccgagagcacgtgaggcgcttcctgcgccggaatgccttcatcttgctcacagtc
agcgctgtgatcattggtgtcagcttggcatttgccttgcgcccgtaccagctctcctac
cgccagatcaagtacttctcctttcctggtgagctgctcatgaggatgctgcagatgctg
gtgttacccctcattgtctccagccttgtcacaggtatggcatccctggacaacaaggcg
acagggcggatgggaatgcgggcagctgtgtactacatggtgactacagtcattgcagtt
ttcatcggcatcctaatggttaccatcatacatcctgggaagggctccaaggaggggctg
caccgtgagggccgaattgagactgtcccaacagctgatgctttcatggacctggtcaga
aatatgtttccacctaaccttgtggaggcctgcttcaaacagtttaagacacagtacagc
acacgagtggtgacaaggacaattgtaaggacagacaatggttcagagctgggggcctcc
atgtctcccacatcctcagtagaaaatgaaaccagcatcctggaaaatgtcacccgggcc
ttgggcaccctgcaggaggtgataagctttgaggagactgtgcctgtacctggctcagcc
aatggcatcaatgccttgggccttgtggtcttctctgtggcctttgggctggtcattggt
ggcatgaagcacaaaggccgtgtcctgagggacttctttgacagcctcaatgaggctatt
atgaggctggtgggcatcatcatctggtatgcaccagtgggcatcctgttcctgattgct
ggaaagattctggaaatggaagacatggctgtccttggaggtcagctgggcatgtacaca
ctgactgtcatcgttggcttattccttcatgctggtggtgtgttgccccttatctacttc
ctcgtcacccatcggaacccctttcccttcattggtggtatgctacaggcactcatcaca
gctatgggtacctcttccagctctgcaactctgcctatcactttccgctgcctggaggag
ggcctgggtgtggatcgtcgcatcaccaggttcgtgctgcctgtgggggccactgtcaac
atggatggcactgcactctacgaggccttggcagccatctttattgctcaagtcaacaac
tatgagctcaaccttggtcagatcaccacaatcagcatcacagccacagctgccagcgta
ggagcagctggcatcccccaggcaggactggttaccatggtgattgtgctcacatccgtc
ggcctgcccacagaggacatcacactgatcatagctgtggattggttccttgaccgactt
cgtacaatgaccaatgtactgggggattcgattggagcggctgtcattgagcatttgtcc
caacgggagctggagctgcaggaggctgagctgactctacccagcctggggaaaccctat
aagtcactcatggcacaagaaaagggggcatcaaggggtcggggaggtaatgagagcgtc
atgtga

DBGET integrated database retrieval system