KEGG   Mus musculus (mouse): 20517
Entry
20517             CDS       T01002                                 

Gene name
Slc22a1, Lx1, Oct1, Orct, Orct1
Definition
(RefSeq) solute carrier family 22 (organic cation transporter), member 1
  KO
K08198  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04976  Bile secretion
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    20517 (Slc22a1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    20517 (Slc22a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20517 (Slc22a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   20517 (Slc22a1)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    20517 (Slc22a1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12
Other DBs
NCBI-GeneID: 20517
NCBI-ProteinID: NP_033228
MGI: 108111
Ensembl: ENSMUSG00000023829
UniProt: O08966
Position
17 A1; 17 8.63 cM
AA seq 556 aa
MPTVDDVLEHVGEFGWFQKQAFLLLCLISASLAPIYVGIVFLGFTPDHHCRSPGVAELSQ
RCGWSPAEELNYTVPGLGSAGEASFLSQCMKYEVDWNQSTLDCVDPLSSLAANRSHLPLS
PCEHGWVYDTPGSSIVTEFNLVCGDAWKVDLFQSCVNLGFFLGSLVVGYIADRFGRKLCL
LVTTLVTSLSGVLTAVAPDYTSMLLFRLLQGMVSKGSWVSGYTLITEFVGSGYRRTTAIL
YQVAFTVGLVGLAGVAYAIPDWRWLQLAVSLPTFLFLLYYWFVPESPRWLLSQKRTTQAV
RIMEQIAQKNRKVPPADLKMMCLEEDASERRSPSFADLFRTPSLRKHTLILMYLWFSCAV
LYQGLIMHVGATGANLYLDFFYSSLVEFPAAFIILVTIDRIGRIYPIAASNLVAGAACLL
MIFIPHELHWLNVTLACLGRMGATIVLQMVCLVNAELYPTFIRNLGMMVCSALCDLGGIF
TPFMVFRLMEVWQALPLILFGVLGLSAGAVTLLLPETKGVALPETIEEAENLGRRKSKAK
ENTIYLQVQTGKSPHT
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgcccaccgtggacgatgtcctggagcacgttggagagtttggctggttccagaagcaa
gccttcctgttgctatgcctgatctcagcttctttagctcccatctacgtgggcatcgtt
ttcctgggcttcacccccgaccaccactgccggagtcctggagtggccgagctgagccag
cggtgtggctggagcccggcagaggagctgaactacaccgtgccgggcctggggtctgcg
ggtgaggcctccttcctcagccaatgcatgaagtatgaggtggactggaaccagagcacc
cttgactgtgtggacccactgtccagcctggctgccaacaggagccacttgccactgagc
ccctgcgagcatggctgggtgtacgacactcccggctcctccatcgtcactgagtttaac
ctggtgtgtggagacgcctggaaagtggacctttttcagtcctgtgtgaacttgggcttc
ttcctgggctccctggttgtgggttacattgcagacaggtttggccgtaagctctgcctc
ctggtgaccactctggtcacctccctgtctggcgtgttaacagcggtggccccagactat
acatccatgttgctctttcgccttctgcaaggcatggtcagcaaaggcagctgggtgtct
ggctacaccttgatcacagagtttgtcggctctggctacaggagaacgacagccatcttg
taccaggtggccttcacagtggggctagtggggcttgctggggtggcctatgccattcca
gactggcgctggctccagctggcggtgtccctgcccaccttcctcttcctgctgtattac
tggtttgtcccagaatccccccggtggctgttgtctcagaagagaaccactcaagcggta
aggataatggagcaaattgcacagaagaacaggaaggtgccccctgctgacctgaagatg
atgtgccttgaggaagatgcctcagagaggcggagtccttcgtttgcagacctgttccgc
acccccagcctgaggaagcacaccctcatcctgatgtatctatggttctcttgtgctgtg
ctgtaccagggcctcatcatgcatgtgggagccacaggggccaacctctacctggacttc
ttttattcttctctagtggaattccctgcggcctttatcatccttgtcaccattgaccgc
attggccgcatctacccaatagcggcatcaaatctggtggcgggggcagcctgcctcctc
atgatctttatcccacatgagctgcattggttgaatgtgaccctcgcttgtcttggccgt
atgggagccaccattgtgttgcagatggtctgcctagtgaacgctgagctgtaccctaca
ttcatcaggaatctcgggatgatggtgtgctctgccctgtgtgacctaggtgggatcttc
acccccttcatggtgttcaggctgatggaagtttggcaagccctgcccctcattttgttt
ggggttttgggcctgagtgctggggctgtgacccttctacttccggagaccaagggcgtg
gctctgcctgagactattgaagaagcggagaacctgggaaggaggaaatcaaaggccaaa
gaaaacacgatttaccttcaggtccaaacaggcaaatccccacatacctga

DBGET integrated database retrieval system