KEGG   Mus musculus (mouse): 20518
Entry
20518             CDS       T01002                                 

Gene name
Slc22a2, Oct2, Orct2
Definition
(RefSeq) solute carrier family 22 (organic cation transporter), member 2
  KO
K08199  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    20518 (Slc22a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20518 (Slc22a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   20518 (Slc22a2)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    20518 (Slc22a2)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 20518
NCBI-ProteinID: NP_038695
MGI: 1335072
Ensembl: ENSMUSG00000040966
UniProt: O70577
Position
17 A1; 17 8.61 cM
AA seq 553 aa
MPTVDDILEHIGEFHLFQKQTFFLLALLSGAFTPIYVGIVFLGFTPNHHCRSPGVAELSQ
RCGWSPAEELNYTVPGLGSAGEVSFLSQCMRYEVDWNQSTLDCVDPLSSLAANRSHLPLS
PCEHGWVYDTPGSSIVTEFNLVCAHSWMLDLFQSLVNVGFFIGAVGIGYLADRFGRKFCL
LVTILINAISGVLMAISPNYAWMLVFRFLQGLVSKAGWLIGYILITEFVGLGYRRTVGIC
YQIAFTVGLLILAGVAYALPNWRWLQFAVTLPNFCFLLYFWCIPESPRWLISQNKNAKAM
KIIKHIAKKNGKSVPVSLQSLTADEDTGMKLNPSFLDLVRTPQIRKHTLILMYNWFTSSV
LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFIIILTIDRIGRRYPWAVSNMVAGAACLA
SVFIPDDLQWLKITVACLGRMGITIAYEMVCLVNAELYPTYIRNLAVLVCSSMCDIGGIV
TPFLVYRLTDIWLEFPLVVFAVVGLVAGGLVLLLPETKGKALPETIEDAEKMQRPRKKKE
KRIYLQVKKAELS
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgccgaccgtggatgatattctagaacatataggggaattccaccttttccagaaacaa
acatttttcctcttagctctgctctccggtgccttcacccccatctatgtgggcatcgtt
ttcctgggcttcacccccaaccaccactgccggagtcctggagtggccgagctgagccag
cgatgtggctggagcccagcagaggagctgaactacaccgtgccgggcctggggtctgcg
ggtgaggtctccttcctcagccagtgcatgaggtatgaggtggactggaaccagagcacc
cttgactgtgtggacccactgtccagcctggctgccaacaggagccacttgccactgagc
ccctgcgagcatggctgggtgtacgacactcccggctcctccatcgtcactgagtttaac
ctagtgtgtgctcactcctggatgctggacctgtttcagtcattagtgaacgtggggttt
ttcatcggtgctgtgggcattggttacctagcagacaggtttgggcggaagttctgcctc
ttggtcaccatcctcatcaatgctatctctggggttctcatggcgatttcacccaactat
gcctggatgttggtgtttcgatttctacagggactggtcagcaaagcgggctggttaatt
ggctatatcctgattacagaatttgttgggctgggctatcgcagaacagtagggatttgt
taccaaatcgcctttactgttgggctcctgatcctggctggagtggcctatgcccttccc
aactggaggtggctgcaatttgccgtgactctgcccaacttctgcttcctgctctatttc
tggtgcataccggagtctccaagatggttgatctcccagaacaaaaatgcaaaagccatg
aaaatcattaagcatattgctaagaaaaatggaaaatcggtgccagtctctcttcagagc
ctgacggcagatgaggatactggcatgaaattgaacccttcgttcctggacttggtcaga
acccctcagataaggaaacatacgttgatcttgatgtacaattggttcacgagctctgtt
ctctaccagggcctcatcatgcacatgggcctcgcaggggacaacatctacttggatttc
ttctactctgccctggtggaattcccagctgccttcatcatcattctcaccatagaccgg
attggtcgccgctatccctgggctgtgtcaaatatggtggcaggagcagcctgcctagct
tcggtttttatccctgatgatctacagtggctgaaaattaccgtggcgtgcttgggtaga
atgggcatcaccatagcctacgaaatggtctgcctggtcaacgctgagctgtaccccaca
tacatcaggaatcttgctgtccttgtctgctcctctatgtgtgacattggtggcatcgtc
acacctttcctggtctaccgtctcactgacatctggctggagttcccgctggtcgtattt
gctgtggttggccttgttgctgggggacttgtgctattgctacctgagaccaaagggaag
gctctgcctgagaccatcgaggatgctgagaagatgcagaggccaagaaaaaagaaagaa
aagagaatttacctccaagttaagaaagcagaactaagctaa

DBGET integrated database retrieval system