KEGG   Mus musculus (mouse): 20526
Entry
20526             CDS       T01002                                 

Gene name
Slc2a2, AI266973, Glut, Glut-, Glut-2, Glut2
Definition
(RefSeq) solute carrier family 2 (facilitated glucose transporter), member 2
  KO
K07593  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04911  Insulin secretion
mmu04917  Prolactin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04950  Maturity onset diabetes of the young
mmu04973  Carbohydrate digestion and absorption
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    20526 (Slc2a2)
   04922 Glucagon signaling pathway
    20526 (Slc2a2)
   04917 Prolactin signaling pathway
    20526 (Slc2a2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    20526 (Slc2a2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    20526 (Slc2a2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    20526 (Slc2a2)
   04950 Maturity onset diabetes of the young
    20526 (Slc2a2)
   04931 Insulin resistance
    20526 (Slc2a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20526 (Slc2a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   20526 (Slc2a2)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    20526 (Slc2a2)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Folate_carrier OATP Phage_holin_2_3
Other DBs
NCBI-GeneID: 20526
NCBI-ProteinID: NP_112474
MGI: 1095438
Ensembl: ENSMUSG00000027690
Vega: OTTMUSG00000035916
UniProt: P14246
Position
3 A3; 3 12.19 cM
AA seq 523 aa
MSEDKITGTLAFTVFTAVLSSFQFGYDIGVINAPQEVIISHYRHVLGVPLDDRKAAINYD
VNGTDTPLTVTPAYTTPAPWDEEETEGSAHIVTMLWSLSVSSFAVGGMVASFFGGWLGDK
LGRIKAMLAANSLSLTGALLMGCSKFGPAHALIIAGRSVSGLYCGLISGLVPMYIGEIAP
TTLRGALGTLHQLALVTGILISQIAGLSFILGNQDHWHILLGLSAVPALLQCLLLLFCPE
SPRYLYIKLEEEVRAKKSLKRLRGTEDVTKDINEMKKEKEEASTEQKVSVIQLFTDANYR
QPILVALMLHMAQQFSGINGIFYYSTSIFQTAGISQPVYATIGVGAINMIFTAVSVLLVE
KAGRRTLFLTGMIGMFFCTIFMSVGLVLLDKFAWMSYVSMTAIFLFVSFFEIGPGPIPWF
MVAEFFSQGPRPTALALAAFSNWVCNFVIALCFQYIADFLGPYVFFLFAGVVLVFTLFTF
FKVPETKGKSFEEIAAEFRKKSGSAPPRKAAVQMEFLASSESV
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgtcagaagacaagatcaccggaaccttggctttcactgtcttcactgctgtactgagt
tccttccagttcggctatgacatcggtgtgatcaatgcacctcaagaggtaataatatcc
cattatcgacatgttttgggtgttccactggatgaccggaaagctgccattaactatgac
gtcaatggcacagacaccccacttacagtcacaccagcatacacaacaccagctccctgg
gatgaagaggagactgaaggatctgctcacatagtcactatgctctggtctctgtctgtg
tccagctttgcagtgggcggaatggtcgcctcattctttggtgggtggctcggggacaaa
cttggaaggatcaaagcaatgttggctgcaaacagcctctcattgactggagccctcttg
atgggatgttccaaatttggaccggcacacgccctcatcattgctggacgaagtgtatca
ggactgtattgtgggctaatttcaggactggttccaatgtacattggagagatcgctcca
accacactcaggggtgccctgggtactcttcaccaactggcccttgtcacaggcattctt
attagtcagattgctggcctcagctttattctgggcaatcaggatcattggcacatccta
cttggcctatctgctgtgccagctcttctgcagtgtctgctactgctcttctgtccagaa
agccccagatacctttatataaagttggaagaggaagtcagggcaaagaaaagcttgaag
agactaagaggaactgaggatgtcaccaaagatattaatgagatgaagaaagaaaaggaa
gaggcatcgactgagcagaaggtctccgtgatccagctcttcacggatgccaattaccga
cagcccatcctcgtggcgctgatgctgcacatggcccagcagttctcaggaatcaatggg
atattttactattcaaccagcatttttcagacagctggcatcagccagcctgtgtatgca
accattggtgttggggccatcaacatgatcttcacggctgtctctgtgctgcttgtggag
aaggcagggcggcggaccctgttcctaaccgggatgattggcatgtttttctgcaccatc
ttcatgtcggtgggacttgtgctgctggataaattcgcctggatgagttacgtgagcatg
actgccatcttcctctttgtcagtttctttgagattgggccaggtccaatcccttggttc
atggttgctgaatttttcagccaaggaccccgtcctacggctctggcactggctgccttc
agcaactgggtctgcaattttgtcatcgccctctgcttccagtacattgcggacttcctt
gggccttacgtgttcttcctcttcgctggggtggtcctggtcttcaccctgtttacattc
tttaaagttccagaaaccaaaggaaagtcttttgaggaaatcgctgcagaattccggaag
aagagtggttcggccccaccacgcaaagctgctgtacaaatggaattcctggcgtcttca
gagagtgtgtga

DBGET integrated database retrieval system