KEGG   Mus musculus (mouse): 20528Help
Entry
20528             CDS       T01002                                 

Gene name
Slc2a4, GT2, Glut-4, Glut4, twgy
Definition
(RefSeq) solute carrier family 2 (facilitated glucose transporter), member 4
  KO
K07191  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    20528 (Slc2a4)
   04152 AMPK signaling pathway
    20528 (Slc2a4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    20528 (Slc2a4)
   04920 Adipocytokine signaling pathway
    20528 (Slc2a4)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    20528 (Slc2a4)
   04931 Insulin resistance
    20528 (Slc2a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20528 (Slc2a4)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   20528 (Slc2a4)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    20528 (Slc2a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 Phage_holin_2_3
Motif
Other DBs
NCBI-GeneID: 20528
NCBI-ProteinID: NP_033230
MGI: 95758
Ensembl: ENSMUSG00000018566
Vega: OTTMUSG00000006028
UniProt: P14142
Position
11 B3; 11 42.93 cM
AA seq 509 aa AA seqDB search
MPSGFQQIGSDDGEPPRQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNATW
LGRQGPGGPDSIPQGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLANNVLAV
LGGALMGLANAAASYEILILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILVAQVLGLESMLGTATLWPLLLALTVLPALLQLILLPFCPESPRYLYIIRNLEGPA
RKSLKRLTGWADVSDALAELKDEKRKLERERPMSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFESAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTCNFIVGMGFQYVADAMGPYVFLLFAVLLLGFFIFTFLKVPETRGRTFDQIS
AAFRRTPSLLEQEVKPSTELEYLGPDEND
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgggtttccagcagatcggctctgacgatggggaaccccctcggcagcgagtg
actggaacactggtcctagctgtattctcagctgtgcttggctcccttcagtttggctat
aacattggggttatcaatgccccacagaaggtgattgaacagagctacaatgcaacgtgg
ctgggtaggcaaggtcctgggggaccggattccatcccacaaggcaccctcactacgctc
tgggctctctccgtggccatcttctctgtgggtggcatgatctcttcctttctcattggc
atcatttctcaatggttgggaaggaaaagggctatgctggccaacaatgtcttggccgtg
ttggggggcgccctcatgggcctagccaatgccgcggcctcctatgagatactcattctt
ggacggttcctcattggcgcctactcagggctaacatcagggctggtgcccatgtatgtg
ggagaaatcgcccccactcatcttcggggtgccttgggaacactcaaccaactggccatc
gtcattggcattctggttgcccaggtgctgggcttggagtctatgctgggcacagctacc
ctgtggccactgcttctggctctcacagtactccctgctctcctgcagctgattctgctg
cccttctgtcctgagagccccagatacctctacatcatccggaacctggaggggcctgcc
cgaaagagtctaaagcgcctgaccggctgggctgatgtgtctgacgcactagctgagctg
aaggatgagaaacggaagttggagagagagcgtccaatgtccttgctccagctcctgggc
agccgcacccaccggcagcctctgatcatcgcagtggtgctgcagctgagccaacagctc
tcaggcatcaatgctgttttctactattcaaccagcatcttcgagtcggctggggtggga
cagccagcctacgccaccataggagctggtgtggtcaatacggtcttcacgttggtctcg
gtgctcttagtagaacgagctggacgacggacactccatctgttgggcctggccggcatg
tgtggctgtgccatcttgatgaccgtggctctgctgctgctggaacgggttccagccatg
agctatgtctccatcgtggccatatttggctttgtggccttctttgagattggccctggc
cccattccctggttcattgtggcagagctcttcagccagggcccccgcccagccgccatg
gctgtcgctggtttctccaactggacctgtaacttcattgtcggcatgggtttccagtat
gttgcggatgctatgggtccttacgtcttccttctatttgccgtcctcctgcttggcttc
ttcatcttcaccttcctaaaagtgcctgaaaccagaggccggacgtttgaccagatctca
gctgccttccgacggacaccttcccttttagagcaggaggtgaaacccagtacagaactt
gaatacttagggccagatgagaatgactga

DBGET integrated database retrieval system