KEGG   Mus musculus (house mouse): 20529
Entry
20529             CDS       T01002                                 
Symbol
Slc31a1, 4930445G01Rik, AI787263, AU016967, Ctr1
Name
(RefSeq) solute carrier family 31, member 1
  KO
K14686  solute carrier family 31 (copper transporter), member 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    20529 (Slc31a1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    20529 (Slc31a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20529 (Slc31a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC31: Copper transporter
   20529 (Slc31a1)
SSDB
Motif
Pfam: Ctr
Other DBs
NCBI-GeneID: 20529
NCBI-ProteinID: NP_780299
MGI: 1333843
Ensembl: ENSMUSG00000066150
UniProt: Q8K211
Position
4:62278821..62310006
AA seq 196 aa
MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDSMMMMPMTFYFDFKNV
NLLFSGLVINTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGT
ILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFL
FSWKKAVVVDITEHCH
NT seq 591 nt   +upstreamnt  +downstreamnt
atgaaccatatggggatgaaccatatggagatgcaccaccatatgggtatgaaccacacg
gacgacaacattaccatgccacctcaccaccacccgaccacctcagcctcacactcccac
ggtggaggggacagcatgatgatgatgcctatgaccttctactttgactttaagaatgtg
aatctattgttttccggtttggtaatcaatacacctggagaaatggctggagccttcgtg
gcagtgtttttactagcaatgttttatgaaggactcaagatagcccgagagggtctgctt
cgaaagtctcaagtcagcattcgctacaattccatgcctgtcccaggaccaaatggaacc
atcctaatggagacacacaaaactgttgggcagcagatgctgagcttcccccacctcctg
cagacagtgctgcacatcatccaggtagtcatcagctacttcctcatgctcatcttcatg
acctacaatgggtacctatgcattgcagtagcagcaggggctgggacgggatactttctc
ttcagctggaagaaggcagtggtggtggacatcacagagcactgccattga

DBGET integrated database retrieval system