KEGG   Mus musculus (mouse): 20531
Entry
20531             CDS       T01002                                 

Gene name
Slc34a2, AA536683, D5Ertd227e, NaPi-2b, Npt2b
Definition
(RefSeq) solute carrier family 34 (sodium phosphate), member 2
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    20531 (Slc34a2)
  09154 Digestive system
   04978 Mineral absorption
    20531 (Slc34a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20531 (Slc34a2)
   04147 Exosome [BR:mmu04147]
    20531 (Slc34a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   20531 (Slc34a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   20531 (Slc34a2)
SSDB
Motif
Pfam: Na_Pi_cotrans
Other DBs
NCBI-GeneID: 20531
NCBI-ProteinID: NP_035532
MGI: 1342284
Ensembl: ENSMUSG00000029188
Vega: OTTMUSG00000026277
UniProt: Q9DBP0
Position
5 C1; 5 28.92 cM
AA seq 697 aa
MAPWPELENAQPNPGKFIEGASGPQSSIPAKDKEASKTNDNGTPVAKTELLPSYSALVLI
EEHPEGTDPWDLPELQDTGIKWSERDTKGKTLCIFQGVGKFILLLGFLYLFVCSLDVLSS
AFQLVGGKVAGQFFSNNSIMSNPVAGLVIGVLVTVMVQSSSTSSSIIVSMVASSLLTVRA
AIPIIMGANIGTSITNTIVALMQAGDRNEFRRAFAGATVHDFFNWLSVFVLLPLEAATHY
LEILTNLVLETFKFQNGEDAPDILKVITDPFTKLIIQLDKKVIQQIAMGDSAAQNKSLIK
IWCKSITNVTEMNVTVPSTDNCTSPSYCWTDGIQTWTIQNVTQKENIAKCQHIFVNFSLP
DLAVGIILLTVSLVVLCGCLIMIVKLLGSVLRGQVATVIKKTLNTDFPFPFAWLTGYLAI
LVGAGMTFIVQSSSVFTSAMTPLIGIGVISIERAYPLTLGSNIGTTTTAILAALASPGNT
LRSSLQIALCHFFFNISGILLWYPIPFTRLPIRLAKGLGNISAKYRWFAVFYLIFFFFVT
PLTVFGLSLAGWPVLVGVGVPIILLLLLVLCLRMLQFRCPRILPLKLRDWNFLPLWMHSL
KPWDNVISLATTCFQRRCCCCCRVCCRVCCMVCGCKCCRCSKCCRDQGEEEEEKEQDIPV
KASGAFDNAAMSKECQDEGKGQVEVLSMKALSNTTVF
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggctccttggcccgagttggaaaatgcccagcccaaccccggtaaattcatcgagggg
gcctctggaccacaatcgagcatacctgccaaagacaaggaggccagcaaaacaaatgac
aacgggactcctgtagccaagactgaactgctaccctcctattccgccctggttctcata
gaggagcatcccgaggggacggacccctgggacctgcctgaactccaggacactgggatc
aaatggtcagagagagacaccaaagggaagacgctctgcattttccagggggttgggaag
ttcattcttctcctggggtttctctacttgttcgtgtgctccctggatgtactgagcagc
gccttccagcttgttggaggcaaagtggccggacagttcttcagcaacaactccatcatg
tctaatcctgtggctggactggtgataggggttctggtgacagtcatggttcaaagctcc
agcacctcttcctccatcatcgtcagcatggttgcttcttcattgctgacggttcgggct
gccatccccatcatcatgggcgctaacattggaacctccatcaccaacacgatcgtggcg
cttatgcaggcaggagacagaaatgagttcagaagggcatttgcaggagccactgttcat
gacttcttcaactggctctctgtgttcgtgctcttgcctctggaggctgccacccattac
ctggagatcctgaccaaccttgtgttagaaaccttcaagttccagaatggagaagatgcc
ccagacattctgaaagtcatcacagaccccttcacaaagctcatcatccagctggataaa
aaggtcatccaacaaatcgcaatgggtgactcagcggcccagaacaagagcctgatcaag
atctggtgtaaaagtataaccaatgtgactgagatgaatgtcaccgtcccctcgactgat
aactgcacctctccttcatattgctggactgatggcatacagacctggaccatccagaac
gttacccaaaaggagaacattgctaaatgtcagcacatcttcgtgaacttcagtctccca
gaccttgctgtgggcatcatcttgcttactgtctccctggtggtcctctgtggctgtctg
atcatgatagtcaagctgttgggttctgtgctcaggggacaagtcgctactgtcatcaag
aagaccctgaatactgatttcccctttccctttgcttggctgactggctacctggccatc
cttgtgggggcaggcatgaccttcatcgtgcaaagcagctctgtgttcacgtctgccatg
actccactcatcggtattggggtgatcagcattgagagggcatatccactcacgttgggc
tccaacattggcaccaccaccaccgccattctggctgctttagccagcccaggcaacacc
ttgaggagttctctccagattgccctgtgccatttcttcttcaacatctctggaatattg
ctttggtacccaatcccattcacccgtctgcccatccgtctggctaaaggcctaggcaac
atctctgccaagtatcgctggttcgcagtcttctatctcatcttcttcttctttgtgacc
ccgctgacagtgtttggcctgtctctggcaggctggccagtgctggtgggcgtgggcgta
cccatcatcctgctgctgctcctggttctgtgcctccggatgctgcagttccgctgccct
cgcatcttgcccctgaagctccgggactggaatttcctacccttgtggatgcactctctg
aaaccctgggacaacgtcatctccctggccaccacctgcttccagaggcgttgctgctgc
tgttgccgcgtgtgctgccgtgtctgctgcatggtgtgcggctgcaagtgctgtcgctgc
agcaagtgctgcagggaccagggagaggaagaggaggagaaggagcaggatatcccggtc
aaggcttctggggcctttgacaatgcagctatgagcaaagagtgccaagatgagggcaag
ggccaagtggaagttctgagcatgaaggccctgtccaacactacagtgttctag

DBGET integrated database retrieval system