KEGG   Mus musculus (mouse): 20533Help
Entry
20533             CDS       T01002                                 

Gene name
Slc4a1, Ae1, CD233, Empb3, l11Jus51
Definition
(RefSeq) solute carrier family 4 (anion exchanger), member 1
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    20533 (Slc4a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20533 (Slc4a1)
   04147 Exosome [BR:mmu04147]
    20533 (Slc4a1)
   04090 CD molecules [BR:mmu04090]
    20533 (Slc4a1)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC4: Bicarbonate transporter
   20533 (Slc4a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   20533 (Slc4a1)
CD molecules [BR:mmu04090]
 Proteins
  20533 (Slc4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto
Motif
Other DBs
NCBI-GeneID: 20533
NCBI-ProteinID: NP_035533
MGI: 109393
Ensembl: ENSMUSG00000006574
Vega: OTTMUSG00000002767
UniProt: P04919 Q53ZN9 Q3TZ29
Position
11 66.29 cM; 11 D
AA seq 929 aa AA seqDB search
MGDMRDHEEVLEIPDRDSEEELENIIGQIAYRDLTIPVTEMQDPEALPTEQTATDYVPSS
TSTPHPSSGQVYVELQELMMDQRNQELQWVEAAHWIGLEENLREDGVWGRPHLSYLTFWS
LLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQDREELLRALLLKRSHAED
LGNLEGVKPAVLTRSGGASEPLLPHQPSLETQLYCGQAEGGSEGPSTSGTLKIPPDSETT
LVLVGRANFLEKPVLGFVRLKEAVPLEDLVLPEPVGFLLVLLGPEAPHVDYTQLGRAAAT
LMTERVFRITASMAHNREELLRSLESFLDCSLVLPPTDAPSEKALLNLVPVQKELLRRRY
LPSPAKPDPNLYNTLDLNGGKGGPGDEDDPLRRTGRIFGGLIRDIRRRYPYYLSDITDAL
SPQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSELLISTAVQGILFALLGAQPLLV
LGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLILLVMLVVAFEGSFLVQYISRYTQ
EIFSFLISLIFIYETFSKLIKIFQDYPLQQTYAPVVMKPKPQGPVPNTALFSLVLMAGTF
LLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDSFIKGTYTQKLSVPDGLKVSN
SSARGWVIHPLGLYRLFPTWMMFASVLPALLVFILIFLESQITTLIVSKPERKMIKGSGF
HLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASGPGAAAQIQEVKEQRIS
GLLVSVLVGLSILMEPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDV
PFVKRVKTWRMHLFTGIQIICLAVLWVVKSTPASLALPFVLILTVPLRRLILPLIFRELE
LQCLDGDDAKVTFDEENGLDEYDEVPMPV
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgggggacatgcgggaccacgaggaagtgctggagatcccagatcgagacagcgaagaa
gaactggagaacataataggacagatagcatatagagacctaaccatccctgtgaccgag
atgcaggacccagaagctcttcccacagagcaaacagccacagactacgtccccagcagt
acctccacaccgcacccaagctccggtcaggtctatgtggagcttcaggaactgatgatg
gaccagaggaaccaggaactacaatgggtggaggcagcgcactggatagggctggaggaa
aaccttcgagaggatggtgtatggggtcgcccacatctatcttacctgaccttctggagc
cttctagaactgcagaaggtcttctcaaaaggcaccttccttctgggtctggcagagaca
tccctggctggggtggccaatcaccttctagactgcttcatctacgaggatcagattcgg
cctcaggaccgagaagaactgctccgggctctgctactcaaacgcagccatgctgaggac
ctagggaatctggagggggtgaagcccgccgtcctgacccgctctgggggcgcctctgag
cctctgcttcctcaccagccatcgctggagacccagctgtactgcggacaggcagagggg
ggctcagaaggaccctcaacatctgggactctgaagatccccccagattcagaaaccaca
ctggtgctagtgggccgggctaattttctggagaagcctgtactgggcttcgtgagactg
aaggaggccgtgcctctggaggacctggtgttgccagagcctgtgggcttccttcttgtt
ctgctgggacctgaggctccgcatgtcgactatacccagctgggcagggctgcagcaact
ctcatgacagaaagagtgttccgcattaccgcctccatggcgcataaccgagaggagctg
ctgcgctctctggagagctttctggactgtagcctggtgctgccgcccacagacgcccct
tcagaaaaagctctgcttaacctggtaccggtgcagaaggagctgcttaggaggcggtac
ctgcccagccccgccaagccagaccccaacttgtacaacactctagacttgaacggggga
aaagggggccctggtgacgaagacgaccctctacggcgcacaggccggatctttggaggc
ctgatccgtgatatccggcgccgttatccttactacctgagtgacatcaccgatgcgctc
agtccccaggtgttggctgctgtcatcttcatctactttgctgccttgtcacctgccgtc
accttcggcggcctcctgggagaaaagacccggaacttgatgggggtgtcggagctgctc
atctccacagcagtgcaaggcattctctttgctctcctgggggcacagcccctgcttgtg
ctaggcttctcaggacccctgctggtgtttgaagaagccttcttctcgttctgtgaaagc
aataacctggagtatatcgtgggccgcgcgtggatcggcttctggctcatcctgctcgtg
atgttggtggtggcctttgaaggcagcttcctcgtccaatacatctcccgatacacccag
gagatcttctccttcctcatctccctcatcttcatctatgagactttctccaagctgatc
aagattttccaggactacccactacaacagacttatgcccctgttgtgatgaagcccaaa
cctcagggccctgtgcccaacacagccctcttctctcttgtgctcatggctggcaccttc
ctacttgccatgacgctacgaaagttcaagaacagcacctacttccctggcaagctgcgt
agagtcattggggacttcggggtccccatctccatcctgataatggtcctggtggattcc
ttcatcaagggcacctacacacagaaactctccgtgcctgatggcctcaaagtgtccaac
tcctccgcccggggctgggtcatccaccctctggggctgtatagacttttccccacgtgg
atgatgtttgcctccgttctgcccgccctgcttgtcttcattctcattttccttgagtct
cagatcaccacgctgattgtcagtaaaccagaacggaagatgatcaagggctctggcttc
cacctggacctgttgctggtcgttggcatgggtggggtggctgccctctttgggatgcct
tggctcagtgccaccactgtaagatctgttacccacgccaatgccctcacagtcatgggg
aaggccagtggtccaggggctgcagcccagatccaagaggtcaaggaacagcggatcagt
gggctcctggtctctgtgcttgtgggactgtccatcctcatggaacctatcctgtcccgc
atccccctggctgtgctcttcggcatcttcctgtacatgggagtcacatccctcagtggc
atccagctctttgaccgcatcttgctcctgttcaagccacccaagtaccacccggatgtg
ccctttgtcaagagggtgaagacctggcgcatgcacctcttcacgggcatccagatcatc
tgcctggctgtgctgtgggtggtgaagtccactcctgcctcgctggccttgcccttcgtc
ctcatcctcacagtgcctctccgtcgtctcatcctcccgctcatcttcagagagctggaa
ctccagtgtctggacggtgatgatgccaaagtgacctttgacgaggagaatggcctggat
gaatatgacgaagtgcccatgcctgtgtga

DBGET integrated database retrieval system