KEGG   Mus musculus (mouse): 20537Help
Entry
20537             CDS       T01002                                 

Gene name
Slc5a1, Sglt1
Definition
(RefSeq) solute carrier family 5 (sodium/glucose cotransporter), member 1
  KO
K14158  solute carrier family 5 (sodium/glucose cotransporter), member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04973  Carbohydrate digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    20537 (Slc5a1)
   04973 Carbohydrate digestion and absorption
    20537 (Slc5a1)
   04978 Mineral absorption
    20537 (Slc5a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20537 (Slc5a1)
   04147 Exosome [BR:mmu04147]
    20537 (Slc5a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   20537 (Slc5a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   20537 (Slc5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF TadF
Motif
Other DBs
NCBI-GeneID: 20537
NCBI-ProteinID: NP_062784
MGI: 107678
Ensembl: ENSMUSG00000011034
Vega: OTTMUSG00000027971
UniProt: Q8C3K6 Q9QXI6 Q8CCA7
Position
5; 5 B1
AA seq 665 aa AA seqDB search
MDSSTLSPAVTATDAPIPSYERIRNAADISVIVIYFVVVMAVGLWAMFSTNRGTVGGFFL
AGRSMVWWPIGASLFASNIGSGHFVGLAGTGAAAGIAMGGFEWNALVLVVVLGWIFVPIY
IKAGVVTMPEYLRKRFGGKRIQIYLSVLSLLLYIFTKISADIFSGAIFINLALGLDIYLA
IFILLAITALYTITGGLAAVIYTDTLQTAIMLVGSFILTGFAFNEVGGYEAFMDKYMKAI
PTKVSNGNFTAKEECYTPRADSFHIFRDPITGDMPWPGLIFGLAILALWYWCTDQVIVQR
CLSAKNMSHVKAGCTLCGYLKLLPMFLMVMPGMISRILYTEKIACVLPEECQKYCGTPVG
CTNIAYPTLVVELMPNGLRGLMLSVMMASLMSSLTSIFNSASTLFTMDIYTKIRKKASEK
ELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFCKRV
NEQGAFWGLILGFLIGISRMITEFAYGTGSCMEPSNCPKIICGVHYLYFAIILFVISVIT
ILIISFLTKPIPDVHLYRLCWSLRNSKEERIDLDAGEEEDIPEDSKDTIEIDTEAPQKKK
GCFRRAYDLFCGLDQDKGPKMTKEEEEAMKMKMTDTSEKPLWRTVVNINGIILLAVAVFC
HAYFA
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggacagtagcaccttgagccccgcggttactgccaccgatgcacccatcccgtcctac
gagcgcattcgcaatgcggctgacatctcagtcatcgtcatctacttcgtggtggtgatg
gctgtcgggctgtgggccatgttttccactaatcgtggtaccgttggaggcttcttcctg
gcaggccgaagtatggtgtggtggccgattggagcctctctctttgccagtaacattgga
agtggtcactttgtggggctggcaggcacaggagcagccgcaggcattgccatgggtggc
tttgaatggaacgccttggttttggtggttgtgctgggctggatatttgtcccgatttac
atcaaggccggggtggtgacgatgccggagtatctgcggaagcggtttggaggcaagaga
attcagatctacctttccgttctgtccctgctcctctacatcttcacaaagatctctgca
gacatcttctccggggctatattcatcaatctagccttgggcctggatatatacttggcc
attttcatcctgctagcaatcactgccctttatacaatcacaggggggctggcagctgta
atttacacagataccctgcagaccgcgatcatgctggtggggtcttttatcctgactggg
tttgctttcaatgaagtaggaggatatgaagccttcatggacaagtacatgaaagctatt
ccaactaaggtttctaacggaaattttaccgccaaggaagaatgctacacaccgagggct
gactcattccacatattcagagaccccattactggagacatgccgtggcctgggctcatt
tttggcctggccatcctcgccctgtggtactggtgtacggatcaggtcattgtgcagcga
tgcctctcggccaagaacatgtctcacgtgaaggctggctgtaccctgtgtggctatctg
aagctactgcccatgttcctcatggtgatgccaggaatgatcagccggattctatataca
gaaaaaatcgcctgtgtcctccctgaagaatgtcagaaatactgcggcacaccagtgggc
tgtaccaacatcgcctaccccacgctcgtggtggaactcatgcctaatggactgcgaggc
ctgatgctgtctgtcatgatggcttccctcatgagctccttgacctccatcttcaacagc
gccagtactctcttcaccatggacatctacaccaagatccggaagaaggcatctgagaag
gagctcatgattgcaggaaggttgttcatcctcgtgctgattggcatcagcattgcctgg
gtacccattgtacagtctgctcaaagtgggcagctctttgattacatccagtctatcacc
agttacctggggccgcccattgcagctgtcttcctgcttgccattttctgcaagagagtc
aatgaacaaggagccttctggggactgatcctgggcttcctgattggaatctcccgtatg
atcactgagtttgcctatggaactgggagctgcatggagcccagcaactgccccaagatc
atctgtggggtccactatttgtactttgccatcatcctcttcgtcatcagcgtcatcacc
atcttgatcatctccttcctcaccaagcccattccagacgtgcacctgtaccgtttgtgt
tggagtctacgcaacagcaaggaagagcgaatcgacctggatgcaggagaggaggaggac
atcccagaggactccaaggacacaattgaaatagacacagaagccccccagaagaagaaa
ggatgcttcaggagagcatatgacctgttctgtgggctggaccaggataaaggaccaaag
atgactaaggaggaggaggaagccatgaagatgaagatgacagacacttctgagaagcct
ttgtggaggacagtggtgaacatcaacggtattatcctgctggcggtagctgtcttctgc
catgcctattttgcctga

DBGET integrated database retrieval system