KEGG   Mus musculus (mouse): 20538Help
Entry
20538             CDS       T01002                                 

Gene name
Slc6a2, NE-T, NET, Slc6a5
Definition
(RefSeq) solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2
  KO
K05035  solute carrier family 6 (neurotransmitter transporter, noradrenalin) member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    20538 (Slc6a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20538 (Slc6a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   20538 (Slc6a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 20538
NCBI-ProteinID: NP_033235
MGI: 1270850
Ensembl: ENSMUSG00000055368
Vega: OTTMUSG00000061538
UniProt: O55192 Q8R2I2
Position
8 C5; 8 44.99 cM
AA seq 617 aa AA seqDB search
MLLARMNPQVQPELGGADPLPEQPLRPCKTADLLVVKERNGVQCLLASQDSDAQPRETWG
KKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYN
REGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLNLPWTNCGHSW
NSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLC
LMVVIVVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFY
RLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFA
IFSILGYMAHEHKVNIEDVATEGAGLVFILYPEAISTLSGSTFWAVLFFLMLLALGLDSS
MGGMEAVITGLADDFQVLKRHRKLFTCVVTISTFLLALFCITKGGIYVLTLLDTFAAGTS
ILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLLFVVVVSIINF
KPLTYDDYTYPPWANWVGWGIALSSMILVPAYVIYKFLSIRGSLWERVAYGITPENEHHL
VAQRDVRQFQLRHWLAI
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggcgcgaatgaatccgcaggtgcagccggagctcggcggggcggacccgctg
cctgagcagcccctgaggccctgcaaaaccgccgatctactagtggtgaaggaacgcaac
ggagtccagtgcctcttggcgtcccaggacagcgacgctcagccccgggagacttggggc
aagaagattgatttcctgctgtccgtggtgggcttcgctgtggacctggccaacgtgtgg
cggttcccttatctctgctacaagaatggtggtggtgccttcctgattccatacacgctg
ttcctcatcattgctgggatgcctctgttttacatggagctggctctggggcaatacaac
cgggagggggcagccacagtgtggaagatctgccctttcttcaaaggagtgggctatgct
gtgatcctcattgccctctatgtcggcttttactacaatgtcatcatcgcctggtcactc
tactacctctttgcatccttcaccttgaacctgccctggaccaactgcggacactcctgg
aacagccccaactgtacggaccccaaactcctcaacgcctcggtgctgggtgaccatacc
aaatactccaaatacaagttcacaccagctgcggagttttatgaacgcggagtcctgcac
ttgcacgagagcagtgggatccatgacatcggcctgcctcaatggcagctgctgctctgt
ctgatggtcgtcatcgttgtcttgtatttcagcctctggaaaggagtgaagacatcagga
aaggttgtctggatcacagccaccctgccttactttgtcttgtttgtgctcctggtccat
ggcgtcacactgcccggtgcctccaatggcatcaatgcctacttgcacattgacttctac
cgcctcaaggaggccacggtatggattgatgctgcaacccagatatttttttctctgggg
gctggatttggagtcttgattgcatttgccagttacaataaatttgacaacaactgttac
agggatgctctactgaccagcaccatcaactgtgttaccagttttatttctggatttgcc
atcttctccatccttggttatatggcccatgaacataaggtcaatattgaggatgttgcc
actgaaggagctgggcttgtgtttatcctgtatccagaagccatctctactctgtcagga
tccacgttctgggccgtcctgttcttcttgatgctcctggctctggggctagatagttca
atgggaggcatggaagcagtcatcactggactggctgatgacttccaggtcctgaagcga
caccggaaactcttcacgtgtgttgtcaccatcagcaccttccttctggcattgttttgc
ataacaaagggagggatttatgtcctcactctgctggacacctttgcagcaggcacctcc
attctgtttgcggtgcttatggaagctattggagtttcctggttttatggtgtggacagg
ttcagcaatgacatccagcagatgatggggtttaagccaggcctgtactggaggctgtgt
tggaagttcgtgagccccgccttcctcctgtttgtggtggtggtcagcatcatcaacttc
aagccgcttacctatgatgactacacctatcctccctgggccaactgggtcgggtggggc
atcgccctctcatccatgatcctggtccctgcctatgtcatctacaagttcctcagcata
cgcggctccctgtgggagagagtggcctacggaatcaccccggagaatgagcaccacctg
gtggcccagagagacgtgagacagttccagttgcggcactggctggctatctga

DBGET integrated database retrieval system