KEGG   Mus musculus (mouse): 20544
Entry
20544             CDS       T01002                                 

Gene name
Slc9a1, A, AW554487, Apnh, Mir5122, Nhe, Nhe-, Nhe1, ant, mir-5122, swe
Definition
(RefSeq) solute carrier family 9 (sodium/hydrogen exchanger), member 1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04919  Thyroid hormone signaling pathway
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    20544 (Slc9a1)
   04024 cAMP signaling pathway
    20544 (Slc9a1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    20544 (Slc9a1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    20544 (Slc9a1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    20544 (Slc9a1)
   04261 Adrenergic signaling in cardiomyocytes
    20544 (Slc9a1)
  09154 Digestive system
   04970 Salivary secretion
    20544 (Slc9a1)
   04971 Gastric acid secretion
    20544 (Slc9a1)
   04972 Pancreatic secretion
    20544 (Slc9a1)
   04976 Bile secretion
    20544 (Slc9a1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    20544 (Slc9a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    20544 (Slc9a1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20544 (Slc9a1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     20544 (Slc9a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   20544 (Slc9a1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 20544
NCBI-ProteinID: NP_058677
MGI: 102462
Ensembl: ENSMUSG00000028854
Vega: OTTMUSG00000011153
UniProt: Q61165 Q3UDC9
Position
4 D2.3; 4 66.25 cM
AA seq 820 aa
MMLRWSGVWGFHPPRIFPSLLVVVALVGLLPVLRSHGLQHSPTASTIRGSEPPRERSIGD
VTTAPSEPLHRPDDHNLTNLIIEHGGKPSRKAFPVLDIDYPHVRTPFEISLWILLACLMK
IGFHVIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYF
LPLRQFTENLGTILIFAVVGTLWNAFFLGGLLYAVCLVGGEQINNIGLLDTLLFGSIISA
VDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFASYDSVGISDIFLGFL
SFFVVALGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMAL
IASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHQWNWTFVIS
TLLFCLIARVLGVLVLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPM
CDLFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIED
ICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGK
IPSAVSTVSMQNIHPKAVTSDRILPALSKDKEEEIRKILRSNLQKTRQRLRSYNRHTLVA
DPYEEAWNQMLLRRQKARQLEQKITNYLTVPAHKLDSPTLSRARIGSDPLAYEPKADLPV
ITIDPASPQSPESVDLVNEELKGKVLGLNRGPRVTPEEEEEDEDGIIMIRSKEPSSPGTD
DVFTPGSSDSPSSQRIQRCLSDPGPHPEPGEGEPFIPKGQ
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgatgcttcggtggtccggcgtctggggatttcatccacctcggatcttcccctccttg
ctggtggtggttgccttggtgggactgctacctgttctcaggagccacggcctccagcac
agccctactgccagcaccatcagaggttctgaaccaccccgggaacgctcaattggggat
gtcaccacggcaccatcagagcctctccatcgcccagatgaccacaatttgaccaactta
atcattgaacatggcggtaagccatctcggaaggccttcccagtcctggacattgactac
cctcacgtgcgcacaccctttgagatctccctctggattctcctggcctgcctcatgaag
ataggtttccatgtgatccccaccatctcaagcatcgtcccggagagctgcctgctgatc
gtagtggggctgctggtggggggcctgatcaagggcgtcggagagacgccccccttcctg
caatcagacgtcttcttcctcttcctgctgccacccatcatcctggatgcaggctacttc
ctgcctctgcggcagttcacggagaacctgggcaccatcctgatctttgctgtggtgggc
acactgtggaatgcgttcttcctgggtggcctcctgtacgccgtgtgcctggtgggcggc
gagcagatcaacaacattggcctgctggacaccctgctctttggcagcatcatctctgcc
gtggaccctgtggctgtgctggccgtcttcgaggagatccacatcaacgaactgctacac
atccttgtcttcggggagtccctgctcaacgatgccgtcactgtggtcctctatcacctc
tttgaggaatttgccagctatgactctgtgggcatctcggacatcttcctcggcttcctg
agcttcttcgtggtggccctcggtggggtgtttgtgggcgtggtctacggggtaatcgca
gctttcacctcccgatttacctctcacatccgggtcatcgagccgctcttcgtcttcctc
tacagctacatggcttacctgtcagctgagctcttccacctgtccggaatcatggccctc
atcgcctcaggagtagtgatgcgcccctatgtggaggccaacatctcccacaaatcccac
accaccatcaagtacttcctgaagatgtggagcagcgtcagtgagaccctcatcttcatc
ttcctcggcgtctccactgtggccggctcccaccagtggaactggaccttcgtcatcagc
accctgctcttctgcctcatcgcccgggtgctgggtgtcctggtcctgacctggttcatc
aacaagttccgcattgtcaagctgacccccaaggaccagttcatcattgcctatgggggc
ctgcgaggggccatcgccttctcgctgggctacctcctggacaagaagcacttccccatg
tgtgacctgttcctcaccgccatcatcaccgtcatctttttcaccgtctttgtgcagggc
atgaccattcggcccctggtcgacctgttggccgtgaagaaaaagcaagaaacaaagcgc
tccatcaacgaggagatccacacacagttcctggaccaccttctgacaggcatcgaggac
atctgtggtcattatggccaccatcactggaaggacaagctcaaccgttttaataagaag
tatgtgaagaagtgcctgatagcaggagagcgctccaaagagccccagctcattgccttc
taccacaagatggagatgaagcaggccattgagctggtggagagcggaggcatgggcaag
atcccatctgctgtctccactgtctctatgcagaacatccaccccaaggctgtgacttca
gaccgcatcttgccagcactgtccaaggacaaggaggaagagatccgcaaaatcttgagg
agcaatctgcagaaaacccggcaacggctgcggtcctataacagacacacgctggtggcc
gacccctacgaggaagcctggaaccagatgctgctccggaggcagaaggcccggcagctg
gagcagaagatcaccaactacctgacagtaccggcccacaagctggactcgcccaccctg
tctcgggcccgcataggctcagacccactggcctatgaacccaaggcagacctgcctgtc
atcaccattgacccggcctccccacagtcccctgagtctgtggacctggtgaacgaggag
ttgaagggcaaggtcctagggctaaaccggggtcccagggtgactccggaggaggaggag
gaagatgaggacggcatcatcatgattcggagcaaggagccctcatccccaggcaccgac
gacgtcttcacccctggatcaagtgacagccccagctcccagagaatacaacgctgcctc
agtgacccaggcccccaccctgagcctggggagggagagcctttcatccccaaaggacag
tag

DBGET integrated database retrieval system