KEGG   Mus musculus (house mouse): 20563
Entry
20563             CDS       T01002                                 
Symbol
Slit2, Drad-1, E030015M03Rik, E130320P19Rik, Slil3, b2b1200.1Clo, mKIAA4141, slit-2
Name
(RefSeq) slit guidance ligand 2
  KO
K06839  slit 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    20563 (Slit2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20563 (Slit2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   20563 (Slit2)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 EGF Laminin_G_1 Laminin_G_2 LRR_9 LRRNT LRRCT hEGF LRR_1 EGF_3 FXa_inhibition
Other DBs
NCBI-GeneID: 20563
NCBI-ProteinID: NP_848919
MGI: 1315205
Ensembl: ENSMUSG00000031558
UniProt: Q9R1B9
Position
5:48138633..48465077
AA seq 1521 aa
MSGIGWQTLSLSLGLVLSILNKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERL
DLNGNNITRITKIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPE
LLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVL
TLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPS
HLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPE
TITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKI
TELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTVAKGTFSALR
AIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSG
TEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTVL
EATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESL
KTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQITTVAPGAFDSLHSLSTLNLLANPFNC
NCHLAWLGEWLRRKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCP
SECTCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNR
ISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDL
SALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQ
GPVDITIQAKCNPCLSNPCKNDGTCNNDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKH
GGTCHLKEGENAGFWCTCADGFEGENCEVNIDDCEDNDCENNSTCVDGINNYTCLCPPEY
TGELCEEKLDFCAQDLNPCQHDSKCILTPKGFKCDCTPGYIGEHCDIDFDDCQDNKCKNG
AHCTDAVNGYTCVCPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIIRINEPICQCL
PGYLGEKCEKLVSVNFVNKESYLQIPSAKVRPQTNITLQIATDEDSGILLYKGDKDHIAV
ELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLTLDSSLSLSVDGGSPKVITNLS
KQSTLNFDSPLYVGGMPGKNNVASLRQAPGQNGTSFHGCIRNLYINSELQDFRKMPMQTG
ILPGCEPCHKKVCAHGMCQPSSQSGFTCECEEGWMGPLCDQRTNDPCLGNKCVHGTCLPI
NAFSYSCKCLEGHGGVLCDEEEDLFNPCQMIKCKHGKCRLSGVGQPYCECNSGFTGDSCD
REISCRGERIRDYYQKQQGYAACQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECTD
GSSFVDEVEKVVKCGCARCAS
NT seq 4566 nt   +upstreamnt  +downstreamnt
atgagtggcattggctggcagacactgtccctatcgctggggttagtgttgtcgatcttg
aacaaggtggcgccgcaggcgtgcccggcccagtgctcctgttcaggcagcacggtggac
tgtcatgggctggcactgcgcagtgtgcccaggaatatcccccgcaacaccgagagactg
gatttgaatggaaataacatcacgaggatcacgaagatagattttgctggtctcaggcac
ctcagagttcttcagctcatggagaacagaatcagcaccatcgagaggggagcattccag
gatcttaaggagctggaaagactgcgtttaaacagaaataaccttcagttgtttcctgag
ctgctgtttctcgggactgcgaagctctaccggcttgatctcagtgaaaatcaaattcaa
gcaattccaaggaaggctttccgtggggcagttgacattaaaaacctgcaactggattac
aaccagatcagctgcattgaagatggggcgttcagagctctacgagatctggaagtgctc
actctgaacaataacaatattactagactttcagtggcaagtttcaaccatatgcctaaa
cttaggacatttcgactccactcgaacaacttgtactgcgactgccacctagcctggctc
tcagactggcttcgccaaaggccacgggtgggcttgtacactcagtgtatgggcccatcc
cacctgaggggccacaatgtagcagaggttcaaaaacgagagtttgtctgcagtggtcac
cagtcattcatggctccctcctgcagtgtgctgcactgccccgctgcttgtacctgtagc
aacaacattgtagactgccgagggaaaggtctcactgagatccccacaaatctgcctgag
accatcacagaaatacgtttggaacagaactccatcagggtcatccctccaggagccttc
tcaccatacaaaaagcttagacgactagacctgagcaacaaccagatctctgaacttgca
ccagatgccttccaaggactgcgctctctgaattcacttgtcctgtatggaaataaaatc
acagaactcccaaaaagtttattcgaaggactattttccttgcagctactattattgaat
gccaacaagataaactgccttcgggtagatgcttttcaggacctgcacaacttgaacctt
ctctccttatatgacaataagcttcagacggttgccaagggcaccttctcagccctcaga
gccatccaaactatgcatttggcccagaatcctttcatttgtgactgccatctcaagtgg
ctagcggattatctccacaccaacccaattgagaccagcggtgcccgttgcaccagcccc
cgccgcctggcaaacaaaagaattggacagatcaaaagcaagaaattccgttgttcaggt
acagaagattatcgatcaaaattaagtggagactgctttgcagacttggcttgtcctgag
aagtgtcgctgtgaagggaccacagtagactgctccaatcaaagactcaacaaaatccct
gaccatattccccagtacacagcagagctgcgtctcaataataatgaattcacagtgtta
gaagccacgggaatatttaagaaacttcctcagttacgtaaaatcaactttagcaacaat
aagatcacggatatcgaggagggtgcatttgaaggcgcgtctggtgtgaatgaaattctt
ctcaccagtaaccgtttggaaaatgttcagcataagatgttcaaaggactggagagcctc
aaaacattgatgctgagaagtaatcgaataagctgtgttgggaacgacagtttcatagga
ctcggctctgtgcgtctgctctctttatatgacaatcaaattaccacagtggcaccagga
gcatttgattctctccattcattatccactctaaacctcttggccaatcctttcaactgt
aactgtcacctggcatggctgggagaatggctcagaaggaaaagaattgtaacaggaaat
cctcgatgccaaaaaccctacttcctgaaggaaatcccaatccaggatgtagccattcag
gacttcacctgtgatgatggaaatgatgacaatagttgctctccactctcccgttgtcct
tctgaatgtacctgcttggatacagtggtacgatgtagcaacaagggcttgaaggttttg
cctaaaggtattccaaaagatgtcacagagctgtatctggatgggaaccagtttacgctg
gtcccgaaggaactctctaactacaaacatttaacacttatagacttaagtaacaaccga
ataagcaccctttccaatcaaagcttcagcaacatgacccagcttctcaccttaatcctc
agttacaaccgtctgagatgtatccctccacgaacctttgatggattgaagtctcttcgg
ttactgtctttacatggaaatgacatttctgttgtgcctgaaggtgccttcaatgacttg
tcagccttgtcacacttagcgattggagccaaccctctttactgtgattgtaacatgcag
tggttatccgactgggtgaagtcggaatataaggaacctggaattgcacgctgtgccggc
cctggagaaatggcagataaattattactcactactccctccaaaaaatttacatgtcaa
ggtcccgtggatatcactattcaagccaagtgtaatccctgcttatcaaatccatgtaaa
aatgatggcacctgtaacaatgaccccgttgatttttatcgatgtacctgcccatatgga
ttcaagggtcaggactgtgatgtccccattcatgcttgtatcagtaatccatgtaaacat
ggaggaacttgtcacttaaaggaaggagagaatgctggattctggtgcacttgtgctgat
gggtttgaaggagaaaactgtgaagtcaatattgatgattgtgaagataatgattgtgaa
aataattctacatgcgttgatggaattaacaactacacatgtctttgcccaccggaatac
acaggtgaactgtgtgaggaaaagctggacttctgtgcacaagacttgaatccctgccag
catgactccaagtgcatcctgactccaaagggattcaagtgtgactgcactccaggatac
attggtgagcactgtgacattgactttgatgactgccaagataacaagtgtaaaaacggt
gctcactgcacagatgccgtgaacggatacacgtgcgtctgtcctgaaggctacagtggc
ttgttctgtgagttttctccacccatggtcctccctcgcaccagcccctgtgataatttt
gattgccagaatggagcccagtgtatcatcaggataaatgaaccaatatgccagtgtttg
cctggctacctgggagagaagtgtgagaaattggtcagtgtgaattttgtaaacaaagag
tcctatcttcagattccttcagccaaggttcggcctcagacaaacatcacacttcagatt
gccacagatgaagacagcggcatcctcttgtataaaggtgacaaagaccacattgccgtg
gaactctatagagggcgagttcgagccagctatgacaccggctctcatccggcttctgcc
atttacagtgtggagacaatcaatgatggaaacttccacattgtggagctactgaccctg
gattccagtctttccctctctgtggatggaggaagccctaaagtcatcaccaatttgtca
aaacaatctactctgaatttcgactctccactctatgtaggaggcatgcctgggaaaaat
aacgtggcatccctgcgccaggcccctgggcaaaatggcaccagcttccatggctgtatc
cggaacctttacattaacagtgagctgcaggacttccggaaaatgcctatgcaaaccgga
attctgcctggctgtgaaccatgccacaagaaagtatgtgcccatggcatgtgccagccc
agcagccaatcaggcttcacctgtgaatgtgaggaagggtggatggggcccctctgtgac
cagagaaccaatgatccctgcctcggaaacaaatgtgtgcatgggacctgcctgcccatc
aatgccttctcctatagttgcaagtgcctggagggccatggcggtgtcctctgtgatgaa
gaagaagatctctttaacccctgccagatgatcaagtgcaagcatgggaagtgcaggctt
tctggagtgggccagccctattgtgaatgcaacagtggattcaccggggacagctgtgat
agagaaatttcttgtcgaggggaacggataagggactattaccagaagcagcagggttac
gctgcctgtcaaacaactaagaaagtatctcgcttggaatgcagaggcgggtgcgctgga
ggccagtgctgtggacctctgagaagcaagaggcggaaatactctttcgaatgcacagat
ggctcctcatttgtggacgaggttgagaaagtggtgaagtgcggctgcgcgagatgtgcc
tcctaa

DBGET integrated database retrieval system