KEGG   Mus musculus (mouse): 20583Help
Entry
20583             CDS       T01002                                 

Gene name
Snai2, Slug, Slugh, Snail2
Definition
(RefSeq) snail family zinc finger 2
  KO
K05706  snail 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    20583 (Snai2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    20583 (Snai2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20583 (Snai2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    20583 (Snai2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-met zf-Di19 zf-BED Elf1 zinc_ribbon_15 KCNQ2_u3 zf-H2C2_5 Zn-ribbon_8 Ogr_Delta DUF4764 Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 20583
NCBI-ProteinID: NP_035545
MGI: 1096393
Ensembl: ENSMUSG00000022676
UniProt: P97469 Q3UZ96
Position
16 A1; 16 10.07 cM
AA seq 269 aa AA seqDB search
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYPIPVIPKPEILTSGAYSPITVWT
SSAAPLHSPLPSGLSPLTGYSSSLGRVSPPPSSDTSSKDHSGSESPISDEEERLQPKLSD
PHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIR
THTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVK
KYQCKNCSKTFSRMSLLHKHEESGCCVAH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctccttcctggtcaagaaacatttcaacgcctccaagaagcccaactacagc
gaactggacacacacacagttattatttccccatatctctatgaaagttaccctatacct
gtcataccaaaaccagagatcctcacctcgggagcatacagccctattactgtatggaca
tcgtcggcagctccactccactctcctttacccagtggcctttctcctcttactggatac
tcctcatccttggggcgtgtaagtcccccgccttcctctgacacttcatccaaggatcac
agtggttcagaaagtcccattagtgacgaagaggagagactgcagcccaagctttcagac
ccccatgccatcgaagctgagaagtttcagtgcaatttatgcaataagacctattctacg
ttctctgggctggccaaacacaagcagctgcactgtgatgcccagtctaggaaatcgttc
agctgcaagtactgtgacaaggaatatgtgagcctgggtgccctgaagatgcacattcga
acccacacattgccttgtgtctgcaagatctgtggcaaggctttctccagaccctggctg
cttcaaggacacattagaactcacactggggaaaagcctttctcttgccctcactgcaat
agggcttttgcagacagatcaaacctgagggcacatctgcagacccactctgatgtaaag
aaataccagtgcaaaaactgctccaaaaccttctccagaatgtcgcttctgcataaacat
gaggagtctggctgctgtgtggcacactga

DBGET integrated database retrieval system