KEGG   Mus musculus (mouse): 20586
Entry
20586             CDS       T01002                                 

Gene name
Smarca4, BAF190A, Brg1, HP1-BP72, SNF2beta, SW1/SNF, b2b508.1Clo, b2b692Clo
Definition
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
  KO
K11647  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2/4 [EC:3.6.4.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04714  Thermogenesis
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    20586 (Smarca4)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    20586 (Smarca4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    20586 (Smarca4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    20586 (Smarca4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     20586 (Smarca4)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     20586 (Smarca4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    20586 (Smarca4)
   PBAF complex
    20586 (Smarca4)
SSDB
Motif
Pfam: SNF2_N Helicase_C Bromodomain SnAC HSA BRK QLQ ResIII DEAD DUF2009
Other DBs
NCBI-GeneID: 20586
NCBI-ProteinID: NP_001167550
MGI: 88192
Ensembl: ENSMUSG00000032187
Vega: OTTMUSG00000037140
UniProt: Q3TKT4
Position
9 A3; 9 7.84 cM
AA seq 1613 aa
MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQG
PGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMAPPPSPMDQHSQGY
PSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGSDPQALGQQNRGPTPFNQNQLHQL
RAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGP
GPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQ
KLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPLVPLHQKQSRITPIQKPRG
LDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEV
VVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSIL
QHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRK
LIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIG
PDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEES
GSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGV
SQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADE
MGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAA
RRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTH
YVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEE
TILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTD
GSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASG
KFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLK
TFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVR
VLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEE
DEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAE
VERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKR
KRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYK
DSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQ
NAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVK
VKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgtctactccagacccacccttgggtgggactcctcggcctggtccttccccaggccct
ggtccttcacctggtgcaatgctgggtcctagccctggcccctcaccaggttctgcccac
agcatgatggggccaagcccaggacctccttcagcaggacatcccatgcccacccagggg
cctggagggtacccccaggacaacatgcatcagatgcacaagcctatggagtccatgcac
gagaagggcatgcctgatgacccacgatacaaccagatgaaagggatgggcatgcggtca
ggggcccacacaggcatggcacctccacctagtcccatggaccagcattctcaaggttac
ccctcacccctcggcggctctgaacatgcctccagtcctgtcccagccagtggcccatct
tcaggcccccagatgtcctctgggccaggaggggccccactagatggttctgatccccag
gccttgggacagcaaaacagaggcccaaccccatttaaccagaaccagctgcatcaactc
agagctcagataatggcctacaagatgttggccaggggccagccattgcccgaccacctg
cagatggccgtgcaaggcaagcggccgatgcctggaatgcagcaacagatgccaacacta
cctccaccctcagtgtccgccacaggacccggacctggacccggccctggccctggccct
ggcccaggaccagcccctccaaattacagtagaccccatggtatgggagggcccaacatg
cctcccccaggaccctcaggtgtgccccccgggatgcctggtcagccgcctggagggcct
cccaagccatggcctgaaggacccatggccaatgctgctgcccccacaagcaccccacag
aagctgattcctccgcaaccaacaggccgtccttcacctgcacctcctgctgtcccgcct
gctgcctcacctgtaatgccaccacaaacacagtccccagggcagccagcccagcctgct
ccattggtgccactgcaccagaagcagagccgaatcacccccatccagaagccccgaggc
cttgaccctgtggagatcctacaagagcgggagtacaggcttcaggctcgaatcgcacac
agaattcaggaacttgaaaacctccctgggtccctggctggggaccttcgaaccaaagca
accatcgaactcaaggcccttaggttgctgaacttccagaggcagctgcgccaggaggtg
gtggtgtgcatgcgaagagacacagccctggagacagccctcaatgccaaggcctacaag
cgcagcaaacgtcagtcactacgggaggcccgcatcactgagaagttggagaagcagcag
aagattgaacaggagcgcaagcgccgccagaagcaccaggagtacctcaacagcattctg
cagcatgccaaggacttcagggagtatcacagatcagtcacaggcaaactccagaaactc
accaaggctgtggccacctaccatgccaacactgagcgggagcagaagaaagaaaatgag
cgcattgagaaggagcgaatgcggaggcttatggctgaagatgaggagggctaccgcaaa
ctcattgaccagaagaaggacaagcgcctggcctaccttctgcagcagacagatgagtat
gtggccaacctcacagagctggtgcggcagcacaaagctgcccaggttgccaaggagaag
aagaagaaaaagaaaaagaagaaggcagaaaatgctgaaggacagacacctgctattgga
ccagatggtgagcctctggatgagaccagccagatgagtgacctccctgtgaaggtgatc
cacgtggagagtggcaagatcctcactggcacagatgccccaaaagccgggcagctggaa
gcctggcttgaaatgaacccagggtatgaagtagcccccaggtcagacagtgaagaaagt
ggctctgaagaggaggaggaggaggaggaagaggagcagcctcagcccgcacagccccct
acactgcctgtggaagaaaagaagaagattccagacccagacagcgatgatgtctctgag
gtggacgcccgacacattattgagaacgccaagcaagatgtggacgatgagtacggtgtg
tcccaggcccttgctcgtggcctgcagtcttactatgctgtggcccatgcagtcacagag
agagtagataagcagtccgccctcatggtcaacggtgtcctcaaacagtaccagatcaag
ggtttggagtggctggtgtccctgtacaacaacaacctgaatggcatcctggctgatgag
atggggctggggaagaccatccagaccatcgcgctcatcacatacctcatggagcacaag
cgcatcaacgggcctttcctcatcatcgtgcctctctcgacactgtcaaactgggcgtat
gaatttgacaagtgggccccctctgtggtgaaggtttcttacaagggctctccagctgca
aggcgagcttttgtcccacagcttcgcagtgggaagttcaacgtcttactgaccacctat
gaatatatcatcaaagacaagcatatcctagccaagatccgctggaagtacatgattgtg
gatgaaggccaccgcatgaaaaaccaccactgcaagttgacgcaggtccttaacacacac
tacgtggcccctcggcgcctgcttcttacaggcacaccactgcagaacaagctaccggag
ctctgggccctgcttaacttcctgctccccactatcttcaagagctgcagcaccttcgaa
cagtggttcaatgcaccctttgccatgactggagaaaaggtggacctgaatgaagaggag
actatcctcattattcgtcgcctacacaaagttctgcggcccttcctgctgcggcggctc
aagaaggaagttgaagcccagctccctgagaaggtagagtatgtcatcaaatgcgacatg
tcagccctgcagcgtgtgctgtaccgtcacatgcaggccaaaggtgtgctgctgactgac
ggctccgagaaggacaagaagggcaaaggtggcaccaagacactgatgaacactattatg
caactgcgtaagatctgcaaccacccctacatgttccagcacatcgaggagtccttttct
gagcacttggggttcaccggcggcatcgtgcaaggattggacctttaccgtgcctcaggg
aaatttgaacttcttgatagaattctacccaaactccgtgcaacgaaccataaagtgctc
ctcttttgccaaatgacctccctcatgaccatcatggaagactactttgcataccgtggc
ttcaaatacctcaggcttgatggaaccacaaaagcagaagaccggggcatgctgttgaaa
acctttaatgaacctggctctgagtatttcattttcctgctcagtacccgtgctgggggg
ctgggcctgaatctgcagtcagctgacactgtgatcatctttgacagtgactggaatccc
caccaggacctgcaagcacaggatcgagcccatcgcattggacagcagaatgaggtgcgt
gttcttcgcctgtgcacggtcaacagtgtggaagagaagatactggctgctgccaaatac
aaactcaatgtggatcagaaggtgatccaggcaggcatgttcgaccagaagtcgtccagc
catgagaggcgtgccttcctgcaggccatcctggagcacgaggagcaggatgaggaggaa
gatgaggtgcctgatgatgagaccgtcaaccagatgattgcccggcacgaagaagagttt
gacctcttcatgcgcatggacttggaccgccggcgtgaagaagcccgcaaccccaagcgg
aagccacgcctgatggaagaggatgagctcccatcctggatcatcaaggatgatgccgag
gtggagcggctgacatgtgaagaggaagaggagaagatgttcggccgtggttctcgccac
cgcaaggaggtagactacagcgactcactgacagagaagcagtggctcaaggctatcgag
gagggcacgctggaggagatcgaagaggaggtccggcagaagaaatcttcacgtaagcgt
aagcgagacagcgaggccggctcctccaccccgaccaccagcacccgcagccgtgacaag
gatgaggagagcaagaagcagaagaaacgtgggcggccacctgctgagaagctgtcccca
aacccacctaacctcaccaagaagatgaagaagatcgtggatgctgtgatcaagtacaaa
gacagcagtggacgtcagctcagcgaggtgttcatccagctcccctctcgcaaggagctt
cctgagtactatgagctcatccgaaagcctgtggacttcaagaagatcaaggaacgcatc
cgaaaccacaagtaccgcagcctcaatgacctggagaaggatgtgatgctgctgtgccag
aacgctcagacgttcaacctcgagggttccctgatctatgaggactccatcgtcctgcag
tctgtcttcaccagcgtacggcagaagattgagaaggaggacgacagtgaaggcgaggaa
agcgaggaggaggaggagggcgaggaggaaggctccgagtctgagtcccgctccgtcaag
gtgaagatcaagctgggccgcaaggagaaggcccaggaccgactcaaggggggccgccgg
cggccaagccggggatcccgggccaagccggttgtgagtgacgatgacagtgaggaggag
caggaggaggaccgctcaggaagtggcagtgaggaagactga

DBGET integrated database retrieval system