KEGG   Mus musculus (mouse): 20598Help
Entry
20598             CDS       T01002                                 

Gene name
Smpd2, AW108287, nSMase, nSMase1
Definition
(RefSeq) sphingomyelin phosphodiesterase 2, neutral
  KO
K12351  sphingomyelin phosphodiesterase 2 [EC:3.1.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    20598 (Smpd2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    20598 (Smpd2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     20598 (Smpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 20598
NCBI-ProteinID: NP_033239
MGI: 1278330
Ensembl: ENSMUSG00000019822
Vega: OTTMUSG00000030684
UniProt: O70572
Position
10; 10 B2
AA seq 419 aa AA seqDB search
MKLNFSLRLRVFNLNCWDIPYLSKHRADRMKRLGDFLNLENFDLALLEEVWSEQDFQYLR
QRLSLTYPDAHYFRSGMIGSGLCVFSKHPIQEIFQHVYSLNGYPYMFHHGDWFCGKSVGL
LVLRLSGLVLNAYVTHLHAEYSRQKDIYFAHRVAQAWELAQFIHHTSKNADVVLLCGDLN
MHPKDLGCCLLKEWTGLHDAFVETEDFKGSDDGCTMVPKNCYVSQQDLGPFPSGIRIDYV
LYKAVSEFHVCCETLKTTTGCDPHSDKPFSDHEALMATLYVKHSPPQEDPCTACGPLERS
DLISVLREARTELGLGIAKARWWAAFSGYVIVWGLSLLVLLCVLAAGEEAREVAIILCIP
SVGLVLVAGAVYLFHKQEAKGLCRAQAEMLHVLTRETETQDRGSEPHLAYCLQQEGDRA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaacttttctctacggctgagagttttcaatctcaactgctgggacatcccc
tacctgagcaaacatagggcggaccgcatgaagcgcttgggagactttctgaacttggaa
aactttgatctggctctcctggaggaggtgtggagtgagcaggacttccagtacctaagg
caaaggctatcgctcacctatccagatgcacactacttcagaagcgggatgataggcagt
ggcctctgtgtgttctccaaacacccaatccaggaaatcttccagcatgtctacagtctg
aatggttacccctacatgttccatcatggagactggttctgtgggaagtctgtggggctg
ctggtgctccgtctaagtggactggtgctcaatgcctacgtgactcatctacatgctgag
tacagccgacagaaggacatctactttgcacaccgtgtggcccaagcttgggaactggcc
cagttcatccaccacacatccaagaatgcagatgtggttctattgtgtggagacctcaat
atgcaccccaaagacctgggctgctgcctgctgaaagagtggacagggctccatgatgct
ttcgttgagactgaggactttaagggctctgatgatggctgtaccatggtacccaagaac
tgctacgtcagccagcaggacctgggaccgtttccgtctggtatccggattgattacgtg
ctttacaaggcagtctctgagttccacgtctgctgtgagactctgaaaaccactacaggc
tgtgaccctcacagtgacaagcccttctctgatcacgaggccctcatggctactttgtat
gtgaagcacagcccccctcaggaagacccctgtactgcctgtggcccactggaaaggtcc
gatttgatcagcgtgctaagggaggccaggacagagctggggctaggcatagctaaagct
cgctggtgggctgcattctctggctatgtgatcgtttgggggctgtcccttctggtgttg
ctgtgtgtcctggctgcaggagaagaggccagggaagtggccatcatcctctgcataccc
agtgtgggtctggtgctggtagcaggtgcagtctacctcttccacaagcaggaggccaag
ggcttatgtcgggcccaggctgagatgctgcacgttctgacaagggaaacggagacccag
gaccgaggctcagagcctcacctagcctactgcttgcagcaggagggggacagagcttaa

DBGET integrated database retrieval system