KEGG   Mus musculus (mouse): 20602
Entry
20602             CDS       T01002                                 

Gene name
Ncor2, N-CoR, SM, SMR, SMRT, SMRTe
Definition
(RefSeq) nuclear receptor co-repressor 2
  KO
K06065  nuclear receptor co-repressor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    20602 (Ncor2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    20602 (Ncor2)
SSDB
Motif
Pfam: GPS2_interact Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 20602
NCBI-ProteinID: NP_001240833
MGI: 1337080
Ensembl: ENSMUSG00000029478
Vega: OTTMUSG00000017150
UniProt: Q9WU42 E9Q9V3
Position
5; 5 G1.1
AA seq 2332 aa
MDRVDREITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENR
KKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWE
QRFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVG
QRGSGLSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGL
MDDPMKVYKDRQVTNMWSEQERDTFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKK
NENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKEEEKQDAE
NEKEELSKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANHEETATPQ
QSSELASMEMNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKR
QNLDEILQQHKLKMEKERNARRKKKKTPAAASEETAFPPAAEDEEMEASGASANEEELAE
EAEASQASGNEVPRVGECSGPAAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQP
PVPPPEEPAVAPAEPSPVPDASGPPSPEPSPSPAAPPATVDKDEQEAPAAPAPQTEDAKE
QKSEAEEIDVGKPEEPEASEEPPESVKSDHKEETEEEPEDKAKGTEAIETVSEAPLKVEE
AGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEGGDKGRLLSPRPSLLTPAGDPRASTS
PQKPLDLKQLKQRAAAIPPIVTKVHEPPREDTVPPKPVPPVPPPTQHLQPEGDVSQQSGG
SPRGKSRSPVPPAEKEAEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHA
ADPSAFSYTPPGHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVLERQLGAISQQGM
SVQLRVPHSEHAKAPMGPLTMGLPLAVDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTA
QETSVLRGTALGSATSGSITKGLPSTRAADGPSYRGSITHGTPADVLYKGTISRIVGEDS
PSRLDRAREDTLPKGHVIYEGKKGHVLSYEGGMSVSQCSKEDGRSSSGPPHETAAPKRTY
DMMEGRVGRTVTSASIEGLMGRAIPEQHSPHLKEQHHIRGSITQGIPRSYVEAQEDYLRR
EAKLLKREGTPPPPPPPRDLTETYKPRPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPR
EELRRTPELPLAPRPLKEGSITQGTPLKYDSGAPSTGTKKHDVRSIIGSPGRPFPALHPL
DIMADARALERACYEESLKSRSGTSSGAGGSITRGAPVVVPELGKPRQSPLTYEDHGAPF
TSHLPRGSPVTTREPTPRLQEGSLLSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISP
YEHLLRGVTGVDLYRGHIPLAFDPTSIPRGIPLEAAAAAYYLPRHLAPSPTYPHLYPPYL
IRGYPDTAALENRQTIINDYITSQQMHHNAASAMAQRADMLRGLSPRESSLALNYAAGPR
GIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHSSSPLSPGGPTHLAKPT
ATSSSERERERERERDKSILTSTTTVEHAPIWRPGTEQSSGAGGSSRPASHTHQHSPISP
RTQDALQQRPSVLHNTSMKGVVTSVEPGTPTVLRWARSTSTSSPVRPAATFPPATHCPLG
GTLEGVYPTLMEPVLLPKETSRVARPERPRVDAGHAFLTKPPAREPASSPSKSSEPRSLA
PPSSSHTAIARTPAKNLAPHHASPDPPAPTSASDLHREKTQSKPFSIQELELRSLGYHSG
AGYSPDGVEPISPVSSPSLTHDKGLSKPLEELEKSHLEGELRHKQPGPMKLSAEAAHLPH
LRPLPESQPSSSPLLQTAPGIKGHQRVVTLAQHISEVITQDYTRHHPQQLSGPLPAPLYS
FPGASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGKRSPEPSKTSVLGSSEDAIEPV
SPPEGMTEPGHARSTAYPLLYRDGEQGEPRMGSKSPGNTSQPPAFFSKLTESNSAMVKSK
KQEINKKLNTHNRNEPEYNIGQPGTEIFNMPAITGAGLMTCRSQAVQEHASTNMGLEAII
RKALMGKYDQWEEPPPLGANAFNPLNASASLPAAAMPITTADGRSDHALTSPGGGGKAKV
SGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFPYN
PLIMRLQAGVMASPPPPGLAAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE
NT seq 6999 nt   +upstreamnt  +downstreamnt
atggaccgcgtggaccgtgagatcaccatggtagagcagcagatctccaagctgaagaag
aagcagcaacagttggaggaggaggccgccaagccgcccgaacccgagaagcctgtgtcg
ccaccacccatagaatcaaagcaccgaagcctggtccagatcatctacgatgagaaccgg
aagaaagccgaagccgcacaccggatcctagaaggcctggggccccaggtggagctgcct
ctgtacaaccagccgtctgacacacgccagtaccatgaaaacatcaaaataaaccaggcg
atgcggaagaagctgatcttgtactttaagcggaggaaccacgcgcgcaagcagtgggaa
cagcgcttctgccagcgctatgaccagctcatggaggcgtgggagaagaaggtagagcgc
atagagaacaatccgcgaaggagggccaaggagagcaaggtgagggagtactacgagaaa
cagttcccggagatccgcaagcagcgggagctgcaggagcgcatgcagagcagggtgggc
cagcgtggcagtgggctctccatgtcggctgcccgcagtgagcatgaggtttctgagatc
attgatggcttgtctgagcaggagaatctggagaagcagatgcgccagctggccgtgatc
ccgcccatgttgtacgacgcggaccagcagaggatcaagttcatcaacatgaatggactc
atggatgaccccatgaaggtctacaaggaccgtcaggttaccaacatgtggagcgagcag
gagagggacaccttccgtgagaagtttatgcagcaccctaagaactttggcctgattgcc
tcattcctggagagaaagacggtcgctgagtgtgtcctctattactacctgaccaagaag
aatgaaaattacaagagcttggtgaggcggagctatcggcgccgtggcaagagccagcag
cagcagcagcagcaacaacagcagcagcagcagcagatggcacggagcagccaggaggag
aaggaggagaaggagaaggagaaggaggccgacaaggaggaagagaagcaggatgcggag
aacgagaaggaagaactcagcaaggagaagacagacgacacttctggcgaggacaacgat
gagaaagaggccgtggcctccaaaggccgcaaaactgccaacagccaaggccgccgcaaa
ggccgtatcacgcgctccatggccaacgaggccaaccatgaggagacagccaccccacag
caaagttcagagctggcttccatggagatgaacgagagttctcgctggactgaggaagag
atggagacagcaaagaaaggcctcctggaacatgggaggaactggtcagccattgcccgt
atggtgggctccaagaccgtgtcccagtgtaagaacttctacttcaactacaagaagagg
cagaacctggacgaaatccttcagcagcacaagctaaagatggagaaggagaggaacgct
cggaggaagaagaagaagaccccagctgcggcgagcgaggagacagccttcccacctgcc
gctgaggacgaagagatggaagcatcaggcgcaagtgccaatgaggaagagctggcggag
gaggcagaagcctcacaggcctctgggaatgaggttcccagagttggggagtgcagtggc
ccagctgctgtcaacaacagctctgatactgagagtgtcccatccccgcgttcagaagcc
acgaaggacactgggcctaaacccactggcactgaagcattgcccgctgccacccagcca
cctgttcctcctccagaagaaccggcagtagcccctgctgagccctccccagtccctgat
gccagtggcccaccatccccagagccttccccatcacctgccgcacccccggctactgtg
gacaaggatgaacaagaagccccggctgctccagctccccagacagaggatgccaaggag
cagaagtctgaggccgaggagatcgatgtgggaaagccagaggagcccgaggcctctgag
gagcccccggagagtgtaaagagtgaccacaaggaggagaccgaggaagagcctgaagac
aaagccaagggcacagaggccattgaaactgtgtctgaggcaccacttaaggtggaggag
gctggtagcaaggcagctgtgaccaagggttccagctcaggtgccacccaggacagtgac
tccagtgccacctgcagtgccgatgaggtggacgaacccgaaggaggtgacaagggcagg
ctgctgtcaccaaggcccagcctcctcaccccggctggagatccccgggccagtacctcg
ccccagaagccgctggacctgaagcagctgaagcagcgagcagccgccatcccccctatc
gtcaccaaggtccatgagcccccccgggaggacacagtacccccaaagccagttccccct
gtgcctccacccacgcagcacctacagccagagggtgacgtgtctcagcagtcgggagga
agtccacgtggcaagtcccgcagcccagtgcctcctgccgagaaagaggcagagaaaccc
gcattctttccggctttcccaactgagggcccaaagctaccgactgagcccccacgctgg
tcatcgggcctgcccttccccatccctccacgggaggtgatcaagacttccccacacgcc
gctgacccctctgccttctcctacacaccccccggtcacccgctgcctctgggcctccac
gatagtgcccggcccgtcctgccacgtccccccatctctaaccccccacccctcatctcc
tctgccaagcatcccggcgtacttgagaggcagctgggtgccatctcccagcaggggatg
tcagtccagcttcgtgtgcctcactcagagcatgccaaggcccccatgggccctctcacc
atggggctgccccttgccgtggaccctaagaagctggcccccttcagtggagtgaagcag
gaacagttgtcccctcggggtcaggctgggccacctgaaagtctgggagtgcccactgct
caggagacctctgtgctgagagggacagcactgggttccgccaccagtggaagcatcacc
aagggcctccccagtacccgggctgcagacggccccagctacagaggctctatcacccac
ggcacgcccgcagacgtcctctacaagggtaccatcagcaggatcgtcggtgaggacagc
ccaagtcgccttgaccgggcacgagaggacaccctgcccaagggccatgtcatctatgag
ggcaagaaaggccacgtcctatcctatgaaggtggtatgtccgtgtcacagtgctctaag
gaggatggaaggagcagctcgggcccaccccatgagactgccgcccctaaacgcacctat
gacatgatggagggccgtgtaggcaggactgtcacctcagccagcatagagggactcatg
ggccgcgccatccctgagcagcacagcccccacctcaaggagcagcatcacatccgaggc
tccatcacgcaaggcatcccgaggtcctatgtggaggcgcaggaggactacttacggcgg
gaggccaagctcttgaagcgagaagggacaccaccacccccaccaccacctcgggacctg
actgagacctacaagccccggcccctggaccctctgggtcccctgaagctgaagccgact
cacgagggtgtggtagcaactgtgaaggaggcgggccgctctatccatgagatcccgaga
gaggagctgcgccgcacacctgagctacccctggcaccacggcctctgaaggagggttcc
atcacccagggcaccccactcaagtacgactctggggcaccctccactggcaccaagaaa
cacgacgtgcgctccatcatcggcagccccggccggcctttccctgccctgcacccgctg
gacataatggctgacgcccgggcactggagcgtgcctgctatgaagagagtctgaagagc
cggtcagggaccagcagtggtgcagggggctccatcacacgtggggctccagtcgtcgtg
cctgaactgggcaagccacggcaaagcccactgacttacgaagaccacggggcacccttc
accagtcacctgccacgtggctcccctgtgaccacgagggagcccacgccacgccttcag
gaaggcagcctcctatccagcaaggcgtcccaggaccggaagctgacatctacaccccgg
gagatcgccaagtccccacacagcactgtgcccgagcaccaccctcaccccatctccccc
tatgagcacttgctccggggcgtgactggtgtggacctgtaccgtggtcacatcccattg
gcctttgaccccacctccataccccgagggatccctctggaagcagcagccgcagcctac
tacctgccccggcacttggcccccagccccacctacccacacctgtacccaccttacctc
atccgcggctaccctgacacggcggccctggagaaccgccagaccatcatcaatgactac
atcacctcgcagcagatgcaccacaacgctgcctccgccatggcccagcgtgctgacatg
ctgaggggtctgtcaccgcgagagtcctcgctggccctcaattatgccgctggcccaaga
ggcattatcgacctgtcccaagtgccacacctgcccgtgctggtgccaccaacgccaggc
acccctgccaccgccatcgaccgccttgcctacctccccactgcgcccccacccttcagc
agccgccacagtagctcaccgctgtccccaggaggccccactcacctagctaaaccaact
gccacatcttcatcggagcgggaacgggaacgtgagcgggaacgagacaagtccatcctc
acgtctaccactacagtggagcatgcacccatctggagacctggtacggagcagagcagc
ggggctgggggcagcagccgccccgcctcccacacccaccagcactcgcccatctccccc
cggacccaggacgccttgcagcagaggcccagtgtgctgcacaacacgagcatgaagggc
gtggtcacctccgtggaacccggcacgcccacggtcctgaggtgggccaggtccacctcc
acctcttcgcctgtccgcccagctgccacattcccacctgccacccactgcccacttggt
ggcacccttgaaggggtctaccctaccctcatggagcccgtcctgttacccaaggagacc
tctcgggtcgcccggcccgagcggccccgtgtggacgctggccatgccttcctcaccaaa
cccccggcccgggagcccgcctcctcacccagcaagagctccgagccccgatccctagca
ccccccagctccagccacacagccatcgcccgcaccccagcaaagaaccttgcaccccac
catgccagtccggacccgccggcgcccacctcggcctcagatctgcaccgagaaaagact
caaagtaaacccttttccatccaggaattggaactccgttctctgggttaccacagtgga
gctggctacagccccgatggggtggagcccatcagcccggtgagctcccccagcctgacc
cacgacaaggggctctccaaacctctggaagagctagagaagagccacttggaaggggag
ctgcggcacaagcagccaggccccatgaagctcagcgcggaggctgcccatctcccacat
ctgcggccactgcccgagagccagccctcatctagcccactcctccagactgccccaggc
atcaaaggtcaccagagggtggtcaccttggctcagcacatcagtgaggtcattacgcag
gactacacgcgccaccacccgcagcagctcagtggcccccttcccgcccctctctactcc
tttcccggagccagctgccctgtcctggatcttcgccgcccacccagtgacctctacctc
ccaccccccgaccatggcaccccagcccggggatccccccacagtgaagggggcaaaagg
tccccagaacccagcaaaacatcggtcctgggcagcagcgaggatgccattgagcctgtg
tccccaccagagggcatgactgagccaggacatgctcggagcactgcgtacccactgctg
tatcgagacggggaacagggcgagcccaggatgggctctaagtctccaggcaacaccagc
cagccgccagccttcttcagtaagctgactgagagcaactccgccatggtgaagtcgaag
aagcaggagatcaacaagaaactcaacacccacaaccggaacgagccagaatacaatatt
ggccagcctgggacggaaatcttcaacatgcccgccatcactggagcaggccttatgacc
tgtagaagccaggcggtgcaagaacacgccagcaccaacatggggctagaggccattatt
agaaaggcactcatgggtaaatatgatcagtgggaagagcccccgccgctcggcgccaat
gcttttaaccctctgaatgccagcgccagtctgcccgctgctgctatgcccataaccact
gctgacggacggagtgaccacgcactcacctcgccaggtggaggtgggaaagccaaggtc
tctggcagacctagcagccgaaaagccaagtcgccagcaccaggcctagcgtccggagac
cgacccccttctgtctcctcagtacactcagagggggactgcaatcgccgaacaccactc
accaaccgtgtgtgggaggaccggccctcatctgcagggtccacgccattcccctacaac
cctttgattatgaggctacaggcaggtgtcatggcctccccgcccccacctggccttgcg
gcaggcagcgggcccctagctggtccccaccacgcctgggatgaggagcccaagccactg
ctgtgttcacagtatgagacactctcggacagcgagtga

DBGET integrated database retrieval system