KEGG   Mus musculus (mouse): 20606Help
Entry
20606             CDS       T01002                                 

Gene name
Sstr2, SRIF-1, SS2R, SSTR-2, Smstr-2, Smstr2, sst2
Definition
(RefSeq) somatostatin receptor 2
  KO
K04218  somatostatin receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04935  Growth hormone synthesis, secretion and action
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    20606 (Sstr2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    20606 (Sstr2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    20606 (Sstr2)
  09154 Digestive system
   04971 Gastric acid secretion
    20606 (Sstr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    20606 (Sstr2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Somatostatin
    20606 (Sstr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv FtsK_4TM
Motif
Other DBs
NCBI-GeneID: 20606
NCBI-ProteinID: NP_001036071
MGI: 98328
Ensembl: ENSMUSG00000047904
Vega: OTTMUSG00000003400
UniProt: P30875
Position
11 E2; 11 79.05 cM
AA seq 369 aa AA seqDB search
MEMSSEQLNGSQVWVSSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVIL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTEDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggagatgagctctgagcagttgaatgggagccaagtgtgggtgtcctctccatttgac
ctcaacggctcactggggccaagcaatggctccaaccagaccgagccatactacgacatg
acaagcaacgccgtcctcacgttcatctacttcgtggtgtgtgttgtcgggctgtgcggc
aacacgctggtcatttatgtcatcctccgctatgccaagatgaagaccatcaccaacatc
tacatccttaacctggccattgcagatgaactcttcatgctagggctgcccttcttggcc
atgcaggtggcgctagtccactggccttttggcaaggccatctgccgggtggtcatgact
gtagatggcatcaatcagttcaccagtatcttctgcttgacggtcatgagcatcgaccgc
tacctggccgtggtgcaccccattaagtcagccaaatggaggcgaccccggacagccaag
atgatcaatgtagctgtgtggtgtgtgtctctgctcgtcattttgcccatcatgatatac
gccggcctccggagcaaccagtggggcaggagcagctgtaccatcaactggccaggcgaa
tccggggcgtggtacacaggtttcattatctacgccttcatcctggggttcctggtaccc
cttaccatcatttgtctctgctacctgttcatcatcatcaaggtgaagtcctctggaatc
cgagtgggatcatccaagaggaaaaagtcagagaaaaaggtgacccgcatggtgtccatc
gtagtggctgtcttcatcttctgctggctccccttctacatcttcaacgtctcttccgtg
tctgtggccatcagtcccaccccagccctgaaaggcatgtttgactttgtggtgatcctc
acctatgccaacagctgcgccaaccccatcctgtacgccttcttgtctgacaacttcaag
aagagcttccagaatgttctttgcttggtcaaggtgagtggtacggaggatggggagagg
agcgacagtaagcaggacaaatcccggctgaatgagaccacggagacccagaggaccctc
ctcaatggagacctccaaaccagtatctga

DBGET integrated database retrieval system