KEGG   Mus musculus (mouse): 20607Help
Entry
20607             CDS       T01002                                 

Gene name
Sstr3, Smstr-3, Smstr3, sst3
Definition
(RefSeq) somatostatin receptor 3
  KO
K04219  somatostatin receptor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    20607 (Sstr3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    20607 (Sstr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    20607 (Sstr3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Somatostatin
    20607 (Sstr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 20607
NCBI-ProteinID: NP_033244
MGI: 98329
Ensembl: ENSMUSG00000044933
UniProt: P30935
Position
15 E1; 15 37.55 cM
AA seq 428 aa AA seqDB search
MATVTYPSSEPTTLDPGNASSTWPLDTTLGNTSAGASLTGLAVSGILISLVYLVVCVVGL
LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV
MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVV
VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR
VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF
FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRIRSQEPGSGPPEKTEEE
EDEEEEERREEEERRMQRGQEMNGRLSQIAQAGTSGQQPRPCTGTAKEQQLLPQEATAGD
KASTLSHL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccactgttacctatccttcatctgagcctacgaccttggaccctgggaacgcatcc
tcgacctggcccctggataccaccctggggaacacatccgctggcgctagcctgacaggc
ctggctgtcagtggcatcttgatctctctggtgtacctggtggtgtgcgtggtgggtttg
ctgggcaactcgctggtgatctacgtggtcctgcggcacacgtccagcccatcagtgacc
agtgtctatatcctcaacctggctctggctgatgagctcttcatgctagggctacccttc
ctggctgctcagaacgccctgtcctactggcccttcggatctctcatgtgccgtctggtc
atggccgtggatggcatcaaccagttcaccagcatcttctgcctcaccgtcatgagtgtg
gaccgctatctggctgtggtgcaccccacacgctcagcccgctggcgcacggcaccagtg
gctcgcacggtcagtgcagctgtctgggtggcctcggctgtggtggtgctgcctgtggtt
gtgttctcaggagtgccccggggcatgagcacgtgccacatgcagtggccagagccagcg
gctgcctggcgaacagccttcatcatctacacggccgcactgggcttctttgggcccctg
ctggtcatctgcttgtgctacttgctcattgtggtaaaggtgcggtcgaccacccggcgg
gtgcgggcgccctcgtgtcagtgggtacaggcacccgcatgccagcggcgacgccgctct
gagcgcagggtcacacgcatggtggtggccgtggtggcactcttcgtcctctgctggatg
cctttctatctgctcaacatcgtcaatgtggtgtgcccgctgccggaggagcccgccttc
ttcggcctctacttcctggtggtggcgctgccctacgccaacagctgcgcaaaccccatc
ctctacggcttcctctcctaccgcttcaagcagggctttcgcaggatcctgctaagacca
tcacgtcgcattcggagccaggagccagggtcgggacctccagagaagactgaagaggag
gaggatgaagaagaagaagagagaagggaagaggaggagcggaggatgcagagagggcag
gagatgaacgggaggctcagtcagatcgcacaggctggcactagtggacaacagccacgg
ccctgcacagggactgctaaggagcagcagcttctgccccaggaggccacagctggggac
aaggccagcacactgagccatctgtaa

DBGET integrated database retrieval system